CAZyme Information: ONH70098.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH70098.1
• CAZy Family: GT71
• CAZyme Description: Mannosyl-oligosaccharide glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766	MPUK01000001|CGC5	87993.77	4.6830

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000001:985952-988252(-)

Full Sequence      

MGVRPRHPHSLISGLMWFNADSTNNLQKARHFCDQGLDFQGFGWDQYDPRLGGHQVMKDN
EFGIDIHTDFVKTEDGNWAMRVKGIPRPGHEKDSNSIVFYTALESPGGMLTSASGSPFEG
FAEGESIKLFGHSIELDGFDIEITDGPDTNTHKVVKRRSLLEPSLDPARTHYMSMNVPED
QAWRIKDIFGVMIQESVQMLAEKHHGSTIEPDPASLLILRNIHNFEGNLHMVQKTFVGEF
EFDIIYNTEKTSERITPENVPALISDVKEKFSKKFQRAFDLKPPFNTPEYEKFGHEVMSN
LLGGIGYYYGDSLVDRDSELNEETYEHIKLDGESEGPYELFAACPSRTFFPRGFYWDEGF
HLIPVLDYDVDLTLEILKSWFNLIDEDGWIAREQILGPEARSKVPHEFQVQSPKIANPPT
LMLVFVELLTRAKQLKDEGGFNGLGDLDEPVQAEGYGEIDFTGITDAHLRYPDLLISYAE
EIYPKLQRHYQWFRRTQKGELDEFDREPYSPREAYRWRGRTYSHCLPSGLDDYPRAPTPD
VGELNVDLISWIGTMTRSMRQMAELLGKTDDAEKYAKIQLEITKNIEDLHWSETDKTYCD
ISVNNEDEDEFFCFKGYISLFPFLLKQMEPGNKHLKDIVELISDPDELFTPYGIRSLSKS
DPKYKTGEDYWRSPIWYNINYLILDSLLHYGSGKNGALLDKETRELANKTYSELRVNLVE
NVKTNFEKTGYVFEQYNDVTGEGQGAKHFYGWTAVVTSIMKMPTSL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	544	761	5.5e-34	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	255	762	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	4.14e-69	1	203	12	213	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.58e-12	447	712	326	567	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	9.69e-10	546	754	578	773	alpha-glucosidase; Provisional
215307	PLN02567	1.08e-05	546	760	328	541	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR37315.1|GH63	0.0	1	766	53	818
AOW29337.1|GH63	2.73e-272	2	766	65	829
ABB97046.1|GH63|3.2.1.106	2.73e-272	2	766	65	829
CAX42430.1|GH63	2.04e-269	2	766	65	829
CAY67585.1|GH63	3.39e-269	1	766	54	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	8.17e-217	2	760	27	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.39e-104	2	760	49	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53008|CWH41_YEAST	8.50e-216	2	760	57	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|O14255|GCS1_SCHPO	7.46e-202	1	760	53	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|Q80UM7|MOGS_MOUSE	3.87e-108	2	760	104	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	8.18e-106	2	760	104	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|F4HTM3|GCS1_ARATH	1.01e-100	2	760	121	845	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ONH70098.1.