CAZyme Information: ONH69371.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH69371.1
• CAZy Family: GT57
• CAZyme Description: Vacuolar acid trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1059	MPUK01000001|CGC6	119151.89	4.8867

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000001:594215-597394(-)

Full Sequence      

MSDATHLRHRDGISRAPKIRSSPLGPGNADGQRSIPPGKTLTTSKLTAMLFLTSLLVPLF
LFSYRVVTATTLVRIPYIEPNYDQVSALEGLCTESHQLFKMVSDSQHCFYDTDHHILGNL
QFSKNMYSRQPYISNGYIGARLSTIGQGFSYDEVNIHADNQTEEVLLNGWPLYNKRYTGA
YVAGFFSLQEKLPSTNFPELYANGYDSVISSLPYWLQLDIEYTDEHGTHLFSPLTVTEDE
ITGYHQNMSIGNGLVSTQLIWRNTLEVKIESFAHKEVLPLSVMSLSLRPLNGSLNVILRD
SLSFNTSQRTTLLDYGADSDGIYMVVRPDNVPYSQAAVYSSCEIQRSGILIDDFSIVSEA
RFDLLEGHVTTIQKYVGVVSTELDEELRGRELEEAKSVVREAKKLGRQELFDEHDKTWTK
QFEDTNIIIPSDDFLTLASRASLFHLLSNTNVQSNKLTSALGTGGLSSDSYGGMVFWDTD
LWIVPGILPFAPDVAKAVSNYRNYTHSQAISNARQYDYDGAAYPWVSGRFGNCTSAGPCV
DYEYHINVDVALSSWLLYLAGEDETYLRYTTWPLLRDAATFLTQFVEYNETLGKYTTHNL
TDPDEYANHVDNGAFTNAGIETTLRVAIRVAKHLEEEVPQRWLDVVGNIYIPVSQDGITL
EYSHMNASVKIKQADVVMLTFPLEFYADSDRAIDDLLYYSLKQADVGPAMTFPIFTAASR
RLFSYGCSSQSYLQKSALPYIRAPFAQFSEQADDNVLTNGGTHPAFPFLTAHGGFLQAVV
YGVLGLKYSTRVNDSTQKIERYLKFDPVRPLALPGGVRVNGIHYLHQRLDISLTDTHGVI
THKGTEPINIEVNCRNDYAGNYTLKPNDTLTVPVFEPPLNVPGSVTECHMIANLTQGMPA
EVALSAVDGNNYTYWQAFDRSPAKLIIDLGERKRLSHGSVIWGHRPAKVFTVWVSDDSLA
TRNRALKDLDDVKFVKVIDRMKVEVSEPFEERYLREVRLLPNNETEFEIDRKFRTIHTRL
VMLEIEGTIDDDDDRSGATVNEFVLFSKDEEIYDDDKDL

Enzyme Prediction     

EC	3.2.1.28:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	440	789	8.1e-92	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224471	ATH1	6.20e-98	95	803	1	661	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
281612	Glyco_hydro_65m	8.09e-36	440	787	1	381	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
237517	PRK13807	4.78e-26	203	676	72	594	maltose phosphorylase; Provisional
397616	Glyco_hydro_65N	5.20e-23	127	381	13	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
395611	F5_F8_type_C	1.15e-04	902	995	13	109	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR37636.1|GH65	0.0	1	1059	1	1059
QNG15616.1|GH65	4.74e-296	95	1045	147	1210
QHS68107.1|GH65	6.69e-296	95	1045	147	1210
CAG61411.1|GH65	6.69e-296	95	1045	147	1210
UCS22251.1|GH65	6.69e-296	95	1045	147	1210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	3.45e-49	406	786	273	640	Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	2.74e-28	319	786	182	693	Crystal structure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	2.86e-22	418	652	277	536	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	6.53e-22	418	652	277	536	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M1RNJ8|ATH1_CANGB	1.68e-296	95	1045	147	1210	Periplasmic/secreted acid trehalase ATH1 OS=Candida glabrata OX=5478 GN=ATH1 PE=1 SV=1
sp|N1P212|ATH1_YEASC	9.44e-278	95	1045	111	1209	Periplasmic acid trehalase ATC1 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) OX=889517 GN=CENPK1137D_1727 PE=1 SV=1
sp|P48016|ATH1_YEAST	9.44e-278	95	1045	111	1209	Periplasmic acid trehalase ATH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATH1 PE=1 SV=1
sp|Q5AAU5|ATC1_CANAL	3.68e-247	61	948	46	960	Cell wall acid trehalase ATC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATC1 PE=1 SV=2
sp|D4B5H9|ATC1_ARTBC	5.63e-121	117	959	69	951	Cell wall acid trehalase ARB_03719 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03719 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999843	0.000152

TMHMM  Annotations     

Start	End
46	68