CAZyme Information: ONH68623.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH68623.1
• CAZy Family: GT3
• CAZyme Description: Cell surface mannoprotein MP65

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MPUK01000002|CGC10	81538.91	5.1785

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000002:1404114-1406879(-)

Full Sequence      

MSDMNLRPRSQRVSQRATRLAQVRTQQQRPPTEAYPGLNDITDAFEALPLDVARYFTLFK
EVHSKYSMHVEPLHKSIAEFKALPRTEEFKKKRSALASHIISKLSSIIPCLDEKMHIAAF
GADNTVKWIKRINDDFELIFKHEIPESVKFGQHNHPAIIHDAKIPDNKSAQSQRSESRRE
ALAAKKAANENNNEEETTPAPATTTSGRGKGRPRAEKEATPSAPTTKKRKTNTAQTNSSG
SANNGSAGNSAGNSTNTAQNFTSNVSNAPTAHSQLLQTVTVTHPQTNALKTEDDSRPGTP
SGSKRSRTSTKKKQEHEQQMQQESEQQEADSWQHGIVSPDEFLLQLEEQKVYIDPTDAPE
FHASTLEETEEEEDPEYEIDYEKGFEYDVEDDDYEMSEEELEEYYATKTTCHEAAPTSVS
ESVEPFADIPSSPADLNIPTLQTKLSIPAAAEHLDHFSDLYVDLLKQVGIENLVKGAWGM
TYSFYRPEGGCKAPQEIQDDIAKLGDFEIIRVYDTDCEGILNVMKLLKPHQKLFAGIYYL
DRIDVSAEIIHQAVMVTGGDWSKVHTVSVGNELVNFGRATTLQVAALVDRAKTVLRARGY
TGYVVTTDTLVAMLNNKELCHIGDYVSVNSHPYWDGLVHPQDSGPWLVQQLDMLRDVCGA
TTPIVLCETGWPTRGLKFGEKGVPSKANQLIALKSIVDTLGFKTILFTTYNDYWKADGTH
GVEKFWGIFDE

Enzyme Prediction     

No EC number prediction in ONH68623.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	491	730	2.9e-17	0.9228295819935691

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.16e-68	476	729	44	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
341098	ING_Pho23p_like	8.30e-38	45	133	1	89	Inhibitor of growth (ING) domain of yeast Pho23p and similar proteins. This family is composed of Saccharomyces cerevisiae transcriptional regulatory protein PHO23 (Pho23p), Schizosaccharomyces pombe chromatin modification-related protein png2 (also called ING1 homolog 2), and similar proteins. Pho23p is part of Rpd3/Sin3 histone deacetylase (HDAC) complex. It is required for the normal function of Rpd3 in the silencing of rDNA, telomeric, and mating-type loci. Pho23p inhibits p53-dependent transcription. The related mammalian ING proteins act as readers and writers of the histone epigenetic code, affecting DNA damage response, chromatin remodeling, cellular senescence, differentiation, cell cycle regulation and apoptosis. They may have a general role in mediating the cellular response to genotoxic stress through binding to and regulating the activities of histone acetyltransferase (HAT) and histone deacetylase (HDAC) chromatin remodeling complexes. All ING proteins contain an N-terminal leucine zipper-like (LZL) motif-containing ING domain that binds unmodified H3 tails, and a well-characterized C-terminal plant homeodomain (PHD)-type zinc-finger domain, binding with lysine 4-tri-methylated histone H3 (H3K4me3). Although these two regions can bind histones independently, together they increase the apparent association of the ING for the H3 tail.
404028	ING	8.24e-15	37	137	1	100	Inhibitor of growth proteins N-terminal histone-binding. Histones undergo numerous post-translational modifications, including acetylation and methylation, at residues which are then probable docking sites for various chromatin remodelling complexes. Inhibitor of growth proteins (INGs) specifically bind to residues that have been thus modified. INGs carry a well-characterized C-terminal PHD-type zinc-finger domain, binding with lysine 4-tri-methylated histone H3 (H3K4me3), as well as this N-terminal domain that binds unmodified H3 tails. Although these two regions can bind histones independently, together they increase the apparent association of the ING for the H3 tail.
366033	Glyco_hydro_17	4.40e-04	602	729	152	297	Glycosyl hydrolases family 17.
341089	ING	4.65e-04	48	118	4	73	Inhibitor of growth (ING) domain family. The Inhibitor of growth (ING) family includes a group of tumor suppressors, ING1-5, which act as readers and writers of the histone epigenetic code, affecting DNA damage response, chromatin remodeling, cellular senescence, differentiation, cell cycle regulation, and apoptosis. They may have a general role in mediating the cellular response to genotoxic stress through binding to and regulating the activities of histone acetyltransferase (HAT) and histone deacetylase (HDAC) chromatin remodeling complexes. All ING proteins contain an N-terminal leucine zipper-like (LZL) motif-containing ING domain that binds unmodified H3 tails, and a well-characterized C-terminal plant homeodomain (PHD)-type zinc-finger domain, which binds lysine 4-tri-methylated histone H3 (H3K4me3). Although these two regions can bind histones independently, together they increase the apparent association of the ING domain for the H3 tail. The ING family also includes three yeast orthologs, chromatin modification-related protein YNG1 (Yng1p), YNG2 (Yng2p), and transcriptional regulatory protein PHO23 (Pho23p). Yng1p, also termed ING1 homolog 1, is one of the components of the NuA3 histone acetyltransferase (HAT) complex. Yng2p, also termed ESA1-associated factor 4, or ING1 homolog 2, is a subunit of the NuA4 HAT complex. It plays a critical role in intra-S-phase DNA damage response. Pho23p is part of Rpd3/Sin3 histone deacetylase (HDAC) complex. It is required for the normal function of Rpd3 in the silencing of rDNA, telomeric, and mating-type loci. Yng1p and Pho23p inhibit p53-dependent transcription. In contrast, Yng2p has the opposite effect.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR37843.1|GH17	3.40e-275	330	731	63	464
AMD21802.1|GH17	6.34e-82	479	731	142	390
BAP71385.1|GH17	8.68e-81	476	731	115	366
QGN15617.1|GH17	1.11e-80	476	731	123	374
BAO39903.2|GH17	2.54e-80	476	731	151	402

PDB Hits     

ONH68623.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04951|SCW10_YEAST	1.97e-74	476	728	135	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	4.93e-74	470	728	126	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	1.63e-70	476	729	125	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q4WC60|BTGE_ASPFU	8.71e-37	474	730	305	562	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|B0Y9Q9|BTGE_ASPFC	8.71e-37	474	730	305	562	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ONH68623.1.