CAZyme Information: ONH68096.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH68096.1
• CAZy Family: GT20
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818	MPUK01000003|CGC11	90697.80	5.4335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000003:82246-84764(-)

Full Sequence      

MADFDIDNVLSQLTLEEKIGLVAGIDFWHTYPVPRLNIPSMRFSDGPNGIRGTKFFNGVP
GAVLPNGTGLAATFDKELLLEAGKLAGIEAHHKSAHVDLGPTANMQRGPNGGRGFESFSE
DPYLAGIASANIVNGLQSQKVAATMKHYVGNDHEHERNSANSIVTDRALREIYLEPFRLA
VKYSQPRAFMTGYNRLNGEHVSQSKKFLEEILRKEWNWDGTIMSDWFGTYTSKESIEAGL
DIEMPGPPKMRTQDHVGQQIASRELHINDLNERVRNVLKLVKYAKESGIPENGPEDTENN
TPETSAFLRKLAADAIVLLKNEDSVLPIKKEETVAVIGPNAKYAAYSGGGSASLAAYYTV
TPYEGISAKTKDPKYTVGAYAHVSLPGLAEQVKNPKTGERGFTLSFYHEPRGSENRRKFD
EFANISSSYHISIFTPEETSEYEFGLTTVGTCQLFVDDKLVVDNKTKQTRGKSFFTSGTI
EEKGRIHLEKGKEYNVRIEFGSGPTYTLTQTEGVNFSGAGCIAFGAARVINDDEEISRAS
ELAKSVDKVILCVGTNGEWESEGYDRSDISLPLRTNDLVSSVLKANPNTVVVNQSGTPCE
FPWIKDAKAVIHAWFGGNELGNAIADVLYGDVNPSGKLSLTFPKKFEDNPAYLNFHSERG
RVLYGEDIFIGYRYYEKLQKQVMFPFGYGLSYTTFQFSDLKVSTDEAAGKLSVSVNVKNT
GKVEGKEVVQVYISKTESDVIRPVKELKDFSKVSLKPGEEKTVKLELSLKDSVSYFDEWE
NKWHAQEGEYSVQVGPSSDDIELIEKFEVKKGFYWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	1.1e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	8.60e-87	6	802	38	758	beta-glucosidase BglX.
224389	BglX	3.05e-66	26	373	48	390	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	9.39e-60	316	672	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	5.61e-40	9	759	56	734	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.48e-33	35	280	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR44766.1|GH3	0.0	1	818	1	839
CDR47499.1|GH3	0.0	2	818	3	839
CAG85284.2|GH3	0.0	1	818	68	904
AMK05628.1|GH3	0.0	1	818	1	837
SGZ46718.1|GH3	0.0	1	818	1	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ABZ_A	0.0	2	818	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
3AC0_A	0.0	1	818	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	8.10e-155	5	809	4	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.33e-112	10	804	9	658	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	8.41e-105	6	809	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	0.0	1	818	1	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|Q9P6J6|BGLS_SCHPO	2.07e-296	1	818	1	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	6.08e-295	1	818	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	3.47e-294	1	818	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q5BB53|BGLI_EMENI	5.65e-293	1	818	1	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999751	0.000295

TMHMM  Annotations     

There is no transmembrane helices in ONH68096.1.