CAZyme Information: ONH68010.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH68010.1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753		82501.21	6.3197

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000003:497842-500143(+)

Full Sequence      

MYDRPAMPLPEEAKKDSPRHKVGGLISKFKKLATHDKHSAPQQVLEQQVHQQETSASNVN
VNVNVSSSGIFGTAISTDAPLSIFSRTTHPVPVPSKVNSNNLPIETNKFYGNMLLENQTN
PVWTHPYSVWFSKDDGFQGLAMNQVPASARVFGPDASANPVQFYFSPTGIKSLVLGSTDF
DSNVTLGLENMNHLSADCKIYSANQGYLLAPLVQGMGFVTGIYYNLIPQIKSAVGFKSCT
GSTSPRSGINKYTILLENNVTWMLYVTIPQGQSLNLALRDGNTVVGDQSVNGAVFQLVAS
DNSSVFDAAAGCYPTRGTLSGSVSNSTGTYSINYNTAGTSNKGTTAMFALPHHVSSFTSD
MASSKTEVTLATTSKGNATCYLTNAFNFSISVPSNISFDPYSAISGKSSPSWSDDVKSKI
TAAATTEVAVSGKILAKYAWILYVTHFVLKNDNLTNKLLPNVKTAIQRFSKNTQSYPLSY
DQTWKGIVSTADSSADFGNSYYNDHHFHYGYHIMAAAVTCAVDKDLGGNFVNEIKNWIND
LCRDIATPDDGDQYFPAFRSFDWYNGHSWAKGLYPSGDGKDEESSSEDYNAYYAMKLWAS
VINDSAMEHRALLQLGIMNGSLNDYFLMANNNTVQPPNFIGNKVTGILFENKVDHTTYFG
MNLEYIQMIHAIPITSFSSFIRSPTFCQEEWNEKLKAIVNDVNDGWKGIIMLNVALFDPS
TSYKFFSDSSFSNSYLDNGQSLTWSLCYSGAFA

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	89	748	2.5e-215	0.9919614147909968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	76	753	62	756	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	413	746	3	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	7.78e-130	89	403	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR46125.1|GH81	0.0	1	753	1	766
QEU61029.1|GH81	2.70e-293	66	752	107	805
CAH00910.1|GH81	3.57e-291	66	752	107	805
CAR25098.1|GH81	1.60e-290	2	752	3	768
CCH62400.1|GH81	9.54e-271	2	752	38	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	4.71e-89	75	746	12	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	7.83e-89	75	746	37	737	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.46e-86	75	746	12	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.33e-22	432	729	343	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	5.27e-21	480	719	418	651	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12168|ENG2_YEAST	8.29e-237	55	753	60	779	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.52e-178	74	753	405	1113	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	6.48e-163	83	746	15	696	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	5.07e-161	68	748	425	1137	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	6.15e-153	70	748	193	898	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ONH68010.1.