CAZyme Information: ONH67651.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH67651.1
• CAZy Family: GH72|CBM43
• CAZyme Description: Mannosyl phosphorylinositol ceramide synthase CSH1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MPUK01000004|CGC6	39896.30	9.1055

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000004:776121-777140(-)

Full Sequence      

MKRELQFLIWAHVFIVVVLLYNVFDLMTLLYDDSFADQLTDLDLNPPPGSPEQPQLIPKI
LHQTYKDTNVPAKWRGAQQKCIDLHPDYQYILWTDEMARDFISEQYPWFLETFDGYKYNI
ERADVIRYFALIHYGGIYIDLDVACERRLDPLLTVPAFVRKTLPTGISNDVMGSVPRHPF
FLKVVDSLQKYDMNYLVPYLTIMYSTGPLFLSVIWKRYRRWVQVPVSGVVRIMFPEDYKK
HTKSFFSVLEGSSWHLGDAQFIKSMGNHIAVAVVAGFLLAAVLLYGEYRLYLWLVNGSYK
NTFIKRWWNKHVRKTHVKRNRKNSNLESYEMNPPIKTEV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	74	153	7.8e-24	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.01e-83	20	301	29	325	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.49e-27	71	153	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR42348.1|GT32	9.05e-256	1	339	1	339
CAR23559.1|GT32	1.93e-152	1	298	1	297
ABN66494.2|GT32	2.80e-152	1	304	1	303
BAO39654.1|GT32	1.65e-149	1	298	1	297
QGN15362.1|GT32	1.65e-149	1	298	1	297

PDB Hits     

ONH67651.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.30e-136	1	301	1	306	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	6.03e-134	1	307	1	303	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.62e-94	56	304	81	328	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.05e-92	53	285	53	285	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.03e-56	43	285	50	292	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999995	0.000034

TMHMM  Annotations     

Start	End
7	29
193	215
269	291