CAZyme Information: ONH66701.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH66701.1
• CAZy Family: GH3
• CAZyme Description: Glucose N-acetyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MPUK01000006|CGC3	64148.81	8.8363

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000006:623820-625475(-)

Full Sequence      

MFSTRSYLRKLHLRIKSNGQALSHQKVTFINAMTPRSKTRSVYLLIAVALLLCLHLLRYS
FPLHSLPLSLPWRASQPQIILPMELIDYDRSTIKRISSQTIDFLYSHTDKTNVKWSRLAY
VTYATSETHLCNAVMLLSDLRSKGTKASLVILLTEDVDISPTIDGSVKRANVIVNRVKRI
QQLNRDSYWTSSMTKMNIFGLIDYERIIYMDSDSQIPQGHLDELFFIPPVEIAVVPAYWL
IAPLFDMSWWSSLMASKNDGNWEPPRPMTHSEKIQYENEFVMNLTRYADSTGKLPVWPFS
KVELTSEQLVTQKNMYTTVYNSLPAHFNIRQFYITSILMVITPSFPLYERAMETLSVSSP
TDFDMELINQMFSLPAILKRQRARKKTLTAIPDLLILPHQRYGLLTSELNVKRKHSTFLA
ELEDIPYIDRSEWRITHSSEAAYYDYTSFEHESSEWLPNVKYLHFSDSPIPKPWIEKDVH
AEYMGHRRRCTPFKESKSNDLKLVKPQYETRDCKAAQAWDQFHAKFSQQRWDVCGLKLIK
LDDDGYASDIH

Enzyme Prediction     

No EC number prediction in ONH66701.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	109	476	1.6e-16	0.914396887159533

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	1.79e-45	119	526	2	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	1.69e-12	119	237	2	121	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	3.20e-11	88	236	45	199	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	3.82e-05	118	286	1	164	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR47787.1|GT8	0.0	1	551	1	551
CDR36819.1|GT8	8.95e-73	83	551	85	572
QLQ81845.1|GT8	6.37e-35	88	479	55	445
AQZ17840.1|GT8	6.73e-35	88	490	56	488
AQZ12802.1|GT8	5.96e-34	88	490	56	488

PDB Hits     

ONH66701.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12096|GNT1_YEAST	1.10e-30	88	534	56	489	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1
sp|Q9Y761|GNT1A_KLULA	1.40e-30	88	479	64	426	Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-A PE=3 SV=1
sp|Q6FQ15|GNT1_CANGA	2.26e-30	88	551	56	499	Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GNT1 PE=3 SV=1
sp|Q59ZI3|GNT1_CANAL	4.71e-28	90	530	46	456	Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GNT1 PE=3 SV=1
sp|Q4HVS2|GNT1_GIBZE	5.56e-28	113	534	150	434	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999994	0.000010

TMHMM  Annotations     

Start	End
42	61