CAZyme Information: ONH66606.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH66606.1
• CAZy Family: GH18
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1409	MPUK01000006|CGC4	160040.21	4.7167

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000006:8891-13179(+)

Full Sequence      

MLPLLPLFWTLVACQINIQLQAQWENPPFSLRLLETVSSENESYYLPALSKIAGFSVYID
DDDDAEGIQELTTDESLYHAVFDLLTPAERALFDIPLANKYHSPRIISHYKHYTDSVVPV
FEKKVTSKCGNHSNTWLKFNDVVYCNPDDVYALMTDSSSTEELVSFDRLIGSSGPILVLY
SNVEDVNFRPFVRNLYEAAQAGKLRFVVRYIPQGLDEKEVLSGYGIDLTLKRTDYIVIDD
RDILREAQEPLGQGAKSNGALLNVHDEDIKAVGKEDIKNLGLQLSSYVMDLEDDETKLNT
LVSIMEELPKYTSHLVKKEITQSFLDQVNYNQKLGISSTGTGIFINGRLLDEDEQTVFGL
YDVIKDELQTVQSLGENGLNSTRSRQVIEKFALLSLYKSRSRPSTRYKLPANDSSPIVFF
NDIENEQLYSSYSTDVASYIGRFQMGQIPEARTNLQTLIFMFDLSDSDHLSILNSVVQAV
RSNGIAQRVGVIPLPLTEHGTTLANNLIHISKTGGMASSRKFIKSLQRSGAVPEEVTDMD
YVSSHVRPFMERFDVNGPVLSVNGAFHDFDNNWVYSMTRQVGEDVNFVFGMAYQKAADTF
EEVSEMFYEDALDFRNTILFPNDKSEIKYRLYDTTKKLGNVFEFTAGSKGNHLATLTLAG
DYGSEFTLTQLREILTLALDSNWDLKVRMIHTSDGVSFLGRLHQALNKSVDHGLAVLDEI
LHEKQFSEAPPSPLVLQALSSMGVESSSFLLLNGRYVELKDRLIKAIYLKSFVQTEIDQR
LSVIQDLLRTDLPASDNIHDWFENVSSLVTLSYYGESQFGAGSIPRFDLSRVRTEHSISF
GERSQSLLHILAVIDPAQELSQRLISLIKAIKGLEMISVDIVLTPQQDMDALPVKRFYKG
NVKGRVEFKDGSLWEEPFVTFENVPSKTLFTLDMDVPASWIVIPKKSRSDLDNVLLSQSG
PVTGVYELESITIEGNAFDAVTNDPPTGLALQIDGSDTSVMTNLGYFQLKANPGIWNLSI
KEGRSSDLYDLVSESELSLFTLKGLHIRSSMKKKSGREGESLLSADEDAVIAKDRGSKLT
SWFSRDQKKKKQADINIFSVASGHLYERLLSIMTVSVMRHTSHTVKFWLIDNYMSPSFRE
FLPYLAEKYGFEYELITYKWPSWLRSQREKQRTIWGYKILFLDVLFPQDLEKVIFVDADQ
IVRTDMIELVEMDLEGAPYGYTPMGDSRKEMEGFRFWKQGYWKKFLGDNLKYHISALYVI
DLKKFRSIAAGDLLRQHYQALSRDPESLSNLDQDLPNNLQQQLKIFSLPQDWLWCETWCD
DESLKTAKTIDLCNNPLTKEPKLDRARRQIPEWTVYDDEISALMKETVYLGQGIGDNEKE
SKAEEEVVRSEVKLNDYLKDEPDLEHDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1095	1343	2.3e-132	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1095	1363	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	4.73e-173	1095	1343	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	2.31e-60	1095	1343	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	1.06e-36	27	212	2	178	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	1.97e-33	974	1064	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR44703.1|GT24	0.0	1	1409	1	1409
ANZ77159.1|GT24	0.0	16	1366	23	1437
AOA68779.1|GT24	0.0	16	1366	23	1435
AOA63808.1|GT24	0.0	16	1366	23	1435
SOP81907.1|GT24	0.0	16	1366	23	1435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	1.69e-241	16	1365	11	1449	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	4.68e-241	16	1365	11	1449	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	1.82e-240	16	1365	11	1449	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	3.90e-206	16	1365	11	1215	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	1.48e-200	16	1305	4	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.40e-213	13	1365	19	1426	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	1.78e-184	16	1364	30	1508	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.11e-180	16	1363	47	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	3.86e-174	16	1363	47	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	2.77e-173	16	1363	47	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.700373	0.299630

TMHMM  Annotations     

There is no transmembrane helices in ONH66606.1.