CAZyme Information: ONH65170.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH65170.1
• CAZy Family: CBM48
• CAZyme Description: Endoglucanase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MPUK01000013|CGC1	55622.94	5.7476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000013:3175-4599(+)

Full Sequence      

MSGFLKVEGTKIVDETGTPVVLKGSATGGHLNMENFITGYPGHETEHKRVLKSKMGEEKF
NFFFEKFYEYFWTEKDAIFFKEELKLNCLRIPFNYRHFIDDEGDMFKINPIGFKRLDAII
DTCSKHGIYTILDLHAVPGGQNQDWHSDSGIHKSLFWDFKVFQDCIINLWREIAKYYKNN
TWVAGYNPLNEPAVSDHSKLVDFYQRVESEIRAVDPNHILYVDGNTYAMDFRQFPEPMPN
TVYAIHDYTVYGFPGFPYNATSEQKAKIKSQYERKLEYMRQYSVPVWNGEFGPVYASKER
GDDNPEEINKVRYQVLKDQLEVYKTGDPSGDGAPISWSIWVYKDIGYQGLCFVDPSSKFY
KVLGDYLLEKKRLGLDRWGNDISPEYSQLYDNLVEHFQQVIPEKHHRSLYPKPWSMKDYI
TRVTRDMLLSQYYQHVYADLLAQLSLEELDELAACFKIENMCKREELNGILREY

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	345	1e-122	0.993006993006993

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.79e-27	72	297	24	242	Cellulase (glycosyl hydrolase family 5).
225344	BglC	4.43e-14	86	347	87	370	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
404153	DUF4038	0.006	86	219	55	175	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR47857.1|GH5_22	0.0	1	474	1	474
SGZ55089.1|GH5_22	4.26e-277	3	474	2	476
SGZ54933.1|GH5_22	8.60e-277	3	474	2	476
QFZ36284.1|GH5_22	8.92e-277	3	474	2	477
QFZ41968.1|GH5_22	8.92e-277	3	474	2	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.38e-13	59	282	16	229	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	3.31e-13	59	282	16	229	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6KDD_A	3.08e-06	87	292	56	262	endoglucanase [Fervidobacterium pennivorans DSM 9078]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	3.81e-158	4	473	3	467	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A3DJ77|GUNC_ACET2	2.95e-13	59	282	16	229	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P23340|GUNC_CLOSF	2.95e-13	59	282	16	229	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|P0C2S3|GUNC_ACETH	7.09e-13	59	282	16	229	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|P16169|GUNA_RUMFL	1.73e-08	89	294	47	262	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ONH65170.1.