CAZyme Information: ONH64935.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH64935.1
• CAZy Family: AA6
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	MPUK01000015|CGC2	94542.50	5.2870

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000015:117128-120457(+)

Full Sequence      

MSAQFDVEDVLSKLTLQEKIGLSAGIDFWHTYPVPRLNIPSLRLSDGPNGIRGTKFFNGV
PGAVLPNGTGLASSFDKELLFEAGKLAGVEARHKSAHVDLGPTTNMQRGPNGGRGFESFS
EDPYLAGIASAEVVKGLQSEHIAATMKHYVCNDLEHERNSSDSLITDRALREIYLEPFRL
AVKFADPKAFMTGYNKINGEHVSQSKKFINDILRNEWEWDGTVMSDWFGTYTSKESIQAG
LDLEMPGPPKMRTEEHVGQQIMSRELHINDLNDRVRGVLKLVKYCLDSGIPENGPEDTKN
NTPETSATLRKFAAESIVLLKNEDQILPLKKEESVAVIGPNAKYAAYSGGGSATLAAYYT
VTPYEGIKNKIGTDPKYTVGAYAHVSLPGLAEQSINPGTGKTGARATFYHEPRGTKNRRK
FDQFDLTSSYHHMVDYKHEEVNADSTFYIDFECEFTPEDTAEYDFGLTVVGTAQLFVDDK
LVVDNKTKQTRGNTFFNQGTIQEVGSIKLEKGKKYNIRIEFGSARTYSITDRDGVDFAGN
GGICFGVARVLDADEEIARACEIAKSVDKVILCMGTNGEWESESYDRANISLPGRSDDLV
SAVLKANPNAVVVNQSGTPCEFPWVKSAKAVVQAWFGGNELGNAIADVLYGDVNPSAKLS
LTFPQKFHDNPAYLNFKTERGRVLYGEDIFVGYRYYEKLQKQVMFPFGYGLSYTTFAFSG
LKVNVDEASNKLSVSIKVKNTGKVEGKEVVQVYIGKTESDVIRPVKELKGFEKVNLKAGE
VKVVDIELSLKDAVSYFDEWENKWHVQDGEYSVYVASHGDGFPYGPSSETLIWVMPLDPR
RDMTLDVTPLLALM

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	246	4.7e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.94e-82	7	815	38	750	beta-glucosidase BglX.
224389	BglX	4.06e-67	27	373	48	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.70e-55	317	693	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	7.14e-43	10	786	56	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.83e-31	36	281	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR47499.1|GH3	0.0	1	820	1	820
CDR44766.1|GH3	0.0	3	820	2	820
CAG85284.2|GH3	0.0	3	842	69	898
ABN67130.1|GH3	0.0	2	820	3	820
AMK05628.1|GH3	0.0	3	820	2	818

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ABZ_A	0.0	3	820	2	826	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
3AC0_A	0.0	3	820	2	826	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	2.02e-144	6	816	4	654	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.28e-110	11	817	9	650	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	4.80e-89	9	809	56	807	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	0.0	3	820	2	826	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	8.61e-294	4	820	3	820	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.73e-293	4	820	3	820	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.73e-293	4	820	3	820	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	5.83e-292	4	821	3	822	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ONH64935.1.