CAZyme Information: ONH64904.1

Basic Information

• Species: Cyberlindnera fabianii
• Lineage: Ascomycota; Saccharomycetes; ; Phaffomycetaceae; Cyberlindnera; Cyberlindnera fabianii
• CAZyme ID: ONH64904.1
• CAZy Family: AA4
• CAZyme Description: putative beta-glucosidase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		91569.15	5.5015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cfabianii65	5509	N/A	0	5509

• Gene Location: location=MPUK01000015:26765-29257(+)

Full Sequence      

MDVDNVLSQLTTPEKISLVSGGDYWHIKAIPRLNVPAIRTSDGPNGIRGLHHFNSTPTAC
VPVGTALGSTWNKKLLYDVGRLLDLEARAKGVHVLLAPTVNIQRIPNGGRGFESFSEDPV
LSGELAAAYINGFQEDGLAATIKHYVCNDQENERFSSDSIVSERALREIYLKPFEIAIKK
SNPKALMTSYNKVNGTHASENQHLYNILRKEWGWDGLVMSDWTGTYSTSEAINTGLDLEM
PGTGRWRGAALNHALFSKTVTDEKLDERVRNVLNLVKSVENSGVPENAPEKQRNTPEDQA
FLRIAAAESVVLLKNDNKVLPLDPQKKVLVVGPNANYAAYSGGGSALATPYYAVPPLDAI
KQKCGDDNVKYEIGAFNHRYMPTLKSQLYIKGTNVNGTLIEIYNEPPTDRDRKPFDVVKL
SNIHYFRMNDYVHPGLKDSNVFYADLTSTFIPDHDGEYEFGAAVFGTAKVFIDGNLVIDN
CTKQEVGESFYGLGTPEVTGTYKVSKGKEYRLKIEFGSGATSPLNGKVNSTFYGGGGLRF
GGVLKISDDEAISRALSHAKQYDQIVFITGLNQDWESEGADRKDLEIPGASGKLIEELVK
VNEDVVVVVQAGTPVEMPWVDKLKTLVYTSYGGNETGNAIADVLFGDVNPSGKLPLTFPY
RFEDTPSFINNTTNLGKVLYGEDVYVGYRYFEKTKREVMFSFGHGLSYTEFKFSDLKVTA
NGDDLNILLTVQNTGSKSGAAVVQLYIQAGPSKTQRPIKELKGFEKVFINAGEKTRITSN
LKIKEATSYYDDEKNKWVSEEGVYTLIAGQSSVDEEALTHEFCTEKTILF

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	241	2.2e-66	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	4.15e-78	29	336	54	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.05e-70	62	814	121	756	beta-glucosidase BglX.
178629	PLN03080	2.76e-46	6	825	56	778	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.36e-39	310	688	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	4.00e-38	62	275	89	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR47121.1|GH3	0.0	1	830	1	830
UPK92097.1|GH3	8.83e-292	2	820	16	834
AJA36818.1|GH3	4.06e-288	1	827	4	832
QNQ00483.1|GH3	8.76e-288	1	827	3	824
QKD55191.1|GH3	7.28e-287	1	814	20	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.21e-258	2	828	5	840	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.02e-254	2	828	5	840	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.75e-132	1	814	3	659	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	3.88e-113	3	812	4	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	5.73e-112	3	812	4	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	7.32e-294	2	827	5	832	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	7.22e-289	1	827	4	832	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.22e-289	1	827	4	832	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.66e-287	1	827	4	832	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	3.45e-287	1	827	4	833	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999862	0.000184

TMHMM  Annotations     

There is no transmembrane helices in ONH64904.1.