CAZyme Information: OJD28360.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD28360.1
• CAZy Family: GT76
• CAZyme Description: FAD-binding PCMH-type domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1J9QIP9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		57382.19	7.8684

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01000014:19350-21143(+)

Full Sequence      

MFRTHSTASTAVRAVHQTSISTAHPVFARCFRQQSRWFGATSRCKDERPSFKGQLYESTQ
QRLIRERAEQARYARAQHDTSPGIRAFAMTVVLLSASLGCYYLGSLKPGSLPATSTTPLA
DTQPPRHNTSPSNLQAAWADFVEIVGKENVSTAKDDVDTHSGSEWSSYAYKEHEKPFLIV
YPSTTEEVSRIMKVCHERLIPVTPYSGGTSLEGQFTSTRGGICIDFQRMGKILALHKEDL
DVVVQPAVGWEDLNEELAKQGLFFPPDPGPGAEIGGMIGTGCSGTNAYRYGTMREWVVSL
TVVLADGTIIKTRQRPRKSSAGYDLTRLFIGSEGTLGLITEATLKVTVKPKSESVVVASF
PTIHNAAECVARIVAEGIPVAGIEILDDVQMKCINASQSTSRTWKEAPTLFLKFTGTPLG
VREQIALVRDLATSTKSQSFEFARNDQEKVELWSARKEALWSVMAMKRNPDDRVWTTDVA
VPISLLPDIIEQTKEDIVKQGLLAGICGHVGDGNFHAAQKAGKG

Enzyme Prediction     

No EC number prediction in OJD28360.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178402	PLN02805	7.37e-124	147	516	107	470	D-lactate dehydrogenase [cytochrome]
223354	GlcD	3.58e-96	140	516	1	377	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	4.99e-45	176	313	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
183043	PRK11230	6.54e-43	176	516	56	393	glycolate oxidase subunit GlcD; Provisional
397178	FAD-oxidase_C	6.63e-32	349	516	1	170	FAD linked oxidases, C-terminal domain. This domain has a ferredoxin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ31245.1|GT31	7.31e-115	163	516	537	870
QGA13141.1|AA4	1.43e-15	114	370	26	289
CDP22417.1|AA4	8.52e-12	125	352	26	271
VBB71413.1|AA4	1.19e-11	125	352	26	271
QVM13434.1|AA4	3.70e-11	115	351	34	277

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LPN_A	1.29e-35	178	516	56	395	Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPN_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens]
3PM9_A	1.56e-32	139	516	19	395	Chain A, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_B Chain B, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_C Chain C, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_D Chain D, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_E Chain E, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_F Chain F, Putative oxidoreductase [Rhodopseudomonas palustris]
2UUU_A	4.11e-24	176	415	138	373	alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_B alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_C alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_D alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUV_A alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_B alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_C alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_D alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum]
4BBY_A	6.76e-23	140	392	163	427	Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_B Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_C Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_D Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BC9_A MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_B MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_C MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_D MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],5ADZ_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5AE1_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE2_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE3_A Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_B Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_C Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_D Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],6GOU_A Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_B Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_C Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_D Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus]
4BC7_A	6.76e-23	140	392	163	427	MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Arg419His mutant [Cavia porcellus],4BC7_B MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Arg419His mutant [Cavia porcellus],4BC7_C MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Arg419His mutant [Cavia porcellus],4BC7_D MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Arg419His mutant [Cavia porcellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32891|DLD1_YEAST	4.01e-128	112	517	85	499	D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD1 PE=1 SV=2
sp|Q12627|DLD1_KLULA	8.13e-128	93	517	58	492	D-lactate dehydrogenase [cytochrome], mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=DLD1 PE=3 SV=2
sp|Q94AX4|DLD_ARATH	9.82e-108	142	516	114	482	D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
sp|F1QXM5|LDHD_DANRE	1.02e-97	126	516	24	409	Probable D-lactate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=ldhd PE=2 SV=1
sp|Q7TNG8|LDHD_MOUSE	8.35e-89	140	516	30	405	Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ldhd PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

Start	End
83	105