CAZyme Information: OJD27653.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD27653.1
• CAZy Family: GT4
• CAZyme Description: Trehalase [Source:UniProtKB/TrEMBL;Acc:A0A1J9RJ69]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704		81674.69	6.5883

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01000078:28781-31399(-)

Full Sequence      

MDEARPLIVPLANRGFSHVVRELRKSSSIPAIPKQILVPRTRRGSHDEGSLPPVFKVWVD
DAMKSLLDQEDTDKNLQITILDNGPKVIPLGTLLSDGGRTREIRGTYLLANLLEELHLTK
GKHASKLIHFSDVSEDPVSRINRKIKDQYWNNLTRRLDESMIEAAAPDPKDWNENPRPRI
FIPYGEERLYDYYCQVSKNKPELKLEVQYLPQGEVTAEFVHGLRDRPGLLALEMDYSNPD
KLRGLQFIVPGGRFNECYYWDSYFACLGLLEIGRIDLVRDILNNFIFQVKHYDKIPNANR
SYYLCRSQPPFLSDLAVRTFHGMDNKEEAAEVLRSGILAAIKEYFTVWMSEPRYDPTTGL
SRFKPPGKGIPLEVEEGHFDAVLYRYAEKYTCTIPEFINQYNSGNVNEPELDEYFMHDRG
VRESGHDTSYRFDQGCADLATVDLNCLLYKYETDIAWAIKMVFNDNLPIPAEWRTSDMAD
DHVETSASWLRRANHRQERANKYLWDPEQRMYFDYNTRTYKRTTYEYVTTLYPLWCGIAS
REQAESLVARALPKFECVGGLSTSTEKSRGQVSMPHRPPKQWDFPFGWAPHQMLAWDGLK
RYGYLHEMERLVYRWLQLMVRVAVNYHGAIVEKYDVTQLDNPSQVNAEYGNQGLDFKYAN
IEGFGWSNASFSYGLSLIKHHKLMVKALGLCVPYDDLRMERIHR

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	136	676	2e-133	0.9653767820773931

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.68e-173	138	678	18	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	3.71e-156	59	681	13	555	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	6.75e-52	211	668	114	526	alpha,alpha-trehalase TreA.
215307	PLN02567	2.75e-50	247	668	143	534	alpha,alpha-trehalase
183936	treA	3.80e-49	247	668	151	526	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51438.1|GH37	0.0	1	703	1	703
QSS69466.1|GH37	0.0	1	703	1	703
CDP26053.1|GH37	2.46e-259	42	695	74	731
VBB76134.1|GH37	2.46e-259	42	695	74	731
CAP73650.1|GH37	2.46e-259	42	695	74	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NIS_A	1.19e-229	59	693	7	638	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5JTA_A	2.61e-229	40	693	78	733	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5N6N_C	5.68e-227	40	693	83	738	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5M4A_A	3.51e-210	110	693	5	585	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	3.35e-45	211	678	80	502	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42783|TREB_NEUCR	8.39e-254	42	695	68	726	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|A0A384JRP0|TREA_BOTFB	4.03e-250	21	696	42	720	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1
sp|O42777|TREB_EMENI	2.11e-248	41	695	74	731	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2
sp|O42622|TREB_MAGO7	9.47e-246	42	695	63	718	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2
sp|J5K1E2|TREA_BEAB2	1.54e-238	16	694	38	724	Cytosolic neutral trehalase OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=NTH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OJD27653.1.