CAZyme Information: OJD27568.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD27568.1
• CAZy Family: GT39
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A1J9QGF0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756		84725.52	6.0728

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01000086:24893-27963(+)

Full Sequence      

MLRPRQSSKGMYQRRSTPRITATRGWREDNTSRGSEAGVPGDGSWNGTVDGEESSEDANR
GGGSFEAEGRARYGLRALRNRGWDWGVRAWRGEGGVGLLLAEEDASIFELTTIAACESIE
ASILDAVKTIPPTTLYKLPNLRSQTLTLRAAIRMNPVLLSSLADCAAIEARRRDHVFIQR
SGPDAFAPNPKYPKLPKGFAFDWKTFKEKYPVKSFVPLPSDPVTRLPRVQHVFSDEAFKG
ILSRQKPRQEAVKQSFIRAWDAYRSYAWMRDEVTPITKGSYDSFGGWAATLVDSLDTLWI
IDLKDEFHEAVRAVANIDFTTTETEEINVFETTIRYLGGLLSAYDLSGEQSLLTKATELG
NILYAAFDTPNRMPVTHWKIHSAFLGLEQEASGVCLLAEVGSLTMEFTRLSQLTKDPKWY
DAVHRIIKILEERQSKTKLPGMWPLVLDARTQNFEGQVHAFTLGAMADSLYEYMPKMHAL
LGGVDGMYERMYKDAMAVVAKHILYRPMVPDNADILISGKVTMNVNGDVELDAEGQHLVC
FAGGMFALGSRLFDIPAHMDIARKLTDGCIWAYNATPSGMMPEVFHMVPCPASEPCMWDE
SRYKEAVVAAHANSVFLPDDKQGDKNNSAEAIIARERLPKGIKSIEDRRYILRPEAIESV
FILYRITGRTELLDTAWDMFTAIEEMTKAPFGNAALNDVTVPRGTAGDAPLSNRMESFWL
AETLKYFYLMFSDPSLVSLDEYVFNTEAHPFRRKKG

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	256	753	1.1e-165	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	256	753	2	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.05e-125	248	755	72	520	glycoside hydrolase family 47 protein; Provisional
271199	LanC_SerThrkinase	0.007	297	430	52	175	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
271200	LanM-like	0.010	337	444	598	695	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS53989.1|GH47	0.0	179	753	23	600
QSS75371.1|GH47	0.0	185	753	29	598
QSS58962.1|GH47	7.60e-223	179	563	23	407
UKZ58250.1|GH47	1.87e-215	194	753	39	583
UKZ69737.1|GH47	3.00e-213	200	753	51	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	4.95e-74	248	750	5	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	5.82e-74	248	750	10	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	6.14e-74	248	750	10	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	2.82e-73	248	750	5	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	4.46e-73	248	750	88	531	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P39098|MA1A2_MOUSE	4.44e-71	246	750	178	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|B2GUY0|MA1B1_RAT	6.16e-71	248	750	207	650	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|Q9UKM7|MA1B1_HUMAN	7.28e-71	248	750	249	692	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|A2AJ15|MA1B1_MOUSE	1.67e-70	248	750	208	651	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|O18498|MA1A1_SPOFR	2.74e-68	246	751	195	642	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000001

TMHMM  Annotations     

There is no transmembrane helices in OJD27568.1.