CAZyme Information: OJD27121.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD27121.1
• CAZy Family: GT34
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
154	LGTZ01000136|CGC1	17575.91	4.5335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01000136:8580-9153(+)

Full Sequence      

MNVAPLDLLPLYALPEMGGVQGGPFWPDKPENITQVSCRMREAVVAVNEIMELKIKGSMR
QRYRGASIALFDTYSLITDMYYHPSQYFTGTEPPNVEDWVKKCDARGQNCEEQPSPDSFM
WYDELHPSEQTGRIIAQHFVQVVEGVSAYAKYFD

Enzyme Prediction     

No EC number prediction in OJD27121.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	1	139	6.6e-19	0.40074906367041196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	9.01e-20	1	142	151	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	4.72e-09	58	141	227	313	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	9.42e-06	65	142	203	280	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
225780	COG3240	4.08e-05	62	137	251	327	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
178701	PLN03156	0.003	65	143	265	346	GDSL esterase/lipase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS59641.1|CE16	1.25e-82	1	154	198	351
QSS54699.1|CE16	2.51e-82	1	154	198	351
BCS15697.1|CE16	2.06e-48	1	154	200	355
BCS04097.1|CE16	2.06e-48	1	154	200	355
USW54667.1|CE16	9.96e-45	2	152	212	365

PDB Hits     

OJD27121.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	3.33e-22	1	154	191	346	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999748	0.000282

TMHMM  Annotations     

There is no transmembrane helices in OJD27121.1.