CAZyme Information: OJD26698.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD26698.1
• CAZy Family: GT22
• CAZyme Description: ABC transporter domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1J9QF11]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
979		111535.00	9.2049

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01000189:235-3563(-)

Full Sequence      

MEYILAFLSLFLYRYARLVVNLWAYHRHKPITPSRASKLTSKDVTVVIPSVDGHGVRLIH
TLQSILQNSPQKVILVTIKKNHMKAEEMIKSLQSLQAIVKVITVHKPNKREQMAAGIREV
ATKITVFADDDDVMWTDSLLQWILSPFEKTTRTGAVGTCQRVQRNPVQSISQSVFRFLGA
LYIERRNFDCAATVHIDGGVPCISGRTAAYRTSILQDQNFIQGFCNETWGGNELDPDDDN
FLTRWMVSQGWDIHIQCHPDALVSTMLEDNPNFLKQCLRWARSNWRSNLRSMFVEMFIWR
RHPYSTYAVYLTTLSPPALVGDAALIWLCNKATEDLMLHHWLLGLLVVWMFISKFIKFLG
YFQRHPSDIILLPISILFGYVHGVIKLYAACTLHVTRWENRERPDGTGKEESPRNQANKK
HLVCNWKKYTHFLWTVAWPAGNIRLQLHCFGLGMLNRMNELGVLSYRDICIFVLLQVLDM
GSLTAAIRIFLLLPLEDYWIKKLKIGSFERIMALSGDFHENNDPNASADLISEAGSFEYQ
MAAIFLQLGPLLLDALLALSTLYYLETRAAFCFIVVVVFYFCVQNLGPQEDLQRQRFHSL
KREKSVVCQSVLNWATVSYFNGFKREKEGLVEAVDTQLDYKKKSAIRSMFKTTMETSGFA
AGFVGACLATARGVTQGDRPVGGLFAMLTYWTRLSEPLKFTVRQIGTLREQAVKMEPFIE
IFEKTPTVVDPEEDAPSATINSGNIDFDRVNFSYDGRRPIFEDFSFKIKSGQTIVIVGAT
GSGKSTLIKLLLRQYSPQSGTIRIDGKDISRVRMETVRENIALAPQHPGFFVNTITDNIR
YANPKASDADVHEACRVAAIHDQILKYPDRYDTVMRADKLSGGERRRLAIARAFIKNAPL
LILDEPTNDLDNKTAAQIRHNMLRRTRGQTTIVISHDINLMKDADKIIVIDSGKVVEEGN
HRTLMHRQGHYYKLYTGKM

Enzyme Prediction     

No EC number prediction in OJD26698.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	43	282	7.8e-31	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224055	MdlB	7.60e-99	502	975	86	561	ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms].
213220	ABCC_ATM1_transporter	7.37e-94	745	975	1	233	ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C. ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
133056	GT2_HAS	6.53e-87	43	287	1	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
184214	PRK13657	7.46e-86	674	974	265	566	glucan ABC transporter ATP-binding protein/ permease.
213216	ABC_MTABC3_MDL1_MDL2	2.25e-85	745	976	1	236	ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins. MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM10758.1|GT2	3.57e-273	6	976	8	998
QGA21882.1|GT2	5.12e-159	6	440	8	446
BCS16742.1|GT2	1.51e-152	6	405	8	410
QQK43830.1|GT2	5.96e-152	6	405	8	410
QKX54999.1|GT2	1.61e-151	6	410	8	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7N58_A	8.86e-64	610	976	345	712	Chain A, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N58_B Chain B, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N59_A Chain A, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N59_B Chain B, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N5A_A Chain A, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N5A_B Chain B, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N5B_A Chain A, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N5B_B Chain B, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana]
6PAR_A	2.73e-60	610	976	227	594	Structure of a bacterial Atm1-family ABC exporter with MgAMPPNP bound [Novosphingobium aromaticivorans DSM 12444],6PAR_B Structure of a bacterial Atm1-family ABC exporter with MgAMPPNP bound [Novosphingobium aromaticivorans DSM 12444],6PAR_C Structure of a bacterial Atm1-family ABC exporter with MgAMPPNP bound [Novosphingobium aromaticivorans DSM 12444],6PAR_D Structure of a bacterial Atm1-family ABC exporter with MgAMPPNP bound [Novosphingobium aromaticivorans DSM 12444],6PAR_E Structure of a bacterial Atm1-family ABC exporter with MgAMPPNP bound [Novosphingobium aromaticivorans DSM 12444],6PAR_F Structure of a bacterial Atm1-family ABC exporter with MgAMPPNP bound [Novosphingobium aromaticivorans DSM 12444],6VQT_A Structure of a bacterial Atm1-family ABC exporter with MgADPVO4 bound [Novosphingobium aromaticivorans DSM 12444],6VQT_B Structure of a bacterial Atm1-family ABC exporter with MgADPVO4 bound [Novosphingobium aromaticivorans DSM 12444],6VQU_A Structure of a bacterial Atm1-family ABC exporter [Novosphingobium aromaticivorans DSM 12444],6VQU_B Structure of a bacterial Atm1-family ABC exporter [Novosphingobium aromaticivorans DSM 12444]
6PAM_A	3.72e-60	610	976	227	594	Structure of a bacterial Atm1-family ABC transporter with MgADP bound [Novosphingobium aromaticivorans DSM 12444],6PAM_B Structure of a bacterial Atm1-family ABC transporter with MgADP bound [Novosphingobium aromaticivorans DSM 12444],6PAM_C Structure of a bacterial Atm1-family ABC transporter with MgADP bound [Novosphingobium aromaticivorans DSM 12444],6PAM_D Structure of a bacterial Atm1-family ABC transporter with MgADP bound [Novosphingobium aromaticivorans DSM 12444],6PAM_E Structure of a bacterial Atm1-family ABC transporter with MgADP bound [Novosphingobium aromaticivorans DSM 12444],6PAM_F Structure of a bacterial Atm1-family ABC transporter with MgADP bound [Novosphingobium aromaticivorans DSM 12444],6PAM_G Structure of a bacterial Atm1-family ABC transporter with MgADP bound [Novosphingobium aromaticivorans DSM 12444],6PAM_H Structure of a bacterial Atm1-family ABC transporter with MgADP bound [Novosphingobium aromaticivorans DSM 12444]
6PAO_A	1.75e-59	610	976	227	594	Structure of a bacterial Atm1-family ABC exporter with ATP bound [Novosphingobium aromaticivorans DSM 12444],6PAO_B Structure of a bacterial Atm1-family ABC exporter with ATP bound [Novosphingobium aromaticivorans DSM 12444]
7D7N_A	2.64e-58	410	971	223	818	Cryo-EM structure of human ABCB6 transporter [Homo sapiens],7D7N_B Cryo-EM structure of human ABCB6 transporter [Homo sapiens],7D7R_A Cryo-EM structure of the core domain of human ABCB6 transporter [Homo sapiens],7D7R_B Cryo-EM structure of the core domain of human ABCB6 transporter [Homo sapiens],7EKM_A Chain A, ATP-binding cassette sub-family B member 6, mitochondrial [Homo sapiens],7EKM_B Chain B, ATP-binding cassette sub-family B member 6, mitochondrial [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F9WWD1|GT2_ZYMTI	1.60e-100	6	407	10	406	Type 2 glycosyltransferase OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) OX=336722 GN=GT2 PE=3 SV=1
sp|G4MWY1|GT2_MAGO7	6.99e-96	6	405	35	432	Type 2 glycosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=GT2 PE=1 SV=1
sp|I1RB03|GT2_GIBZE	1.80e-93	7	423	40	453	Type 2 glycosyltransferase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GT2 PE=2 SV=1
sp|Q02592|HMT1_SCHPO	3.00e-85	417	973	230	814	Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hmt1 PE=2 SV=3
sp|Q2UPC0|ACLQ_ASPOR	1.04e-70	433	976	219	785	ABC transporter aclQ OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aclQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999501	0.000520

TMHMM  Annotations     

Start	End
306	328
341	363
369	391
469	491
543	565
570	587