CAZyme Information: OJD26160.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD26160.1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		47287.32	9.4180

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01000265:18227-19569(-)

Full Sequence      

MEYRTLFWFLFCYRYVRLVVNCIAVLLYKPIPPPENPSFTSRDVTVIVPTLEGHGEQFME
TLKTICTAKPHEIILSTVDKNRKKAEETANYIRECLQIRVKVTSVPNPNKRHQTVVAIDE
VDIAQTAIIILADDDVQWPPNPFPLFLAPFQDPKMGGVATRQCLLRTDNLGFFKRVFEFL
GALYLERRNFDCTATMFMDGGVPCLSGRTLILRTIMVKDTAFRRYFLNEKWFWMPLSADD
DNSITRWIINHGWKMYFQNLPGAEVKTTLESDLKFLKQCIRWSRSNWRSNLRSLLERATW
RRYPWSTYAVFLSTPTQLTIVTEPLLIWLCHKMTEADAMLRLRSILQLLGFIASTKFIKL
VGHYRQHPWDLVLFPVSILFGYFHGLIKIYSLFTLGKATWGNREC

Enzyme Prediction     

No EC number prediction in OJD26160.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	43	284	2e-26	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	2.15e-80	43	289	1	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
404520	Glyco_tranf_2_3	4.12e-26	42	285	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.64e-12	6	312	16	310	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	9.72e-06	46	224	1	163	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
132997	Glyco_tranf_GTA_type	0.001	46	202	1	153	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21882.1|GT2	3.18e-143	10	404	12	408
QSS59839.1|GT2	1.08e-140	13	404	12	400
QKX54999.1|GT2	8.91e-139	10	404	12	407
QSS56442.1|GT2	6.88e-137	3	404	7	409
QSS62020.1|GT2	4.13e-136	13	404	8	400

PDB Hits     

OJD26160.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F9WWD1|GT2_ZYMTI	3.31e-110	11	404	15	401	Type 2 glycosyltransferase OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) OX=336722 GN=GT2 PE=3 SV=1
sp|G4MWY1|GT2_MAGO7	1.52e-108	5	403	34	428	Type 2 glycosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=GT2 PE=1 SV=1
sp|I1RB03|GT2_GIBZE	6.07e-104	3	403	31	433	Type 2 glycosyltransferase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GT2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999707	0.000319

TMHMM  Annotations     

Start	End
371	393