CAZyme Information: OJD25612.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD25612.1
• CAZy Family: GT17
• CAZyme Description: GPI mannosyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:A0A1J9RC97]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441		49155.92	9.8656

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01000345:17407-18806(+)

Full Sequence      

MQSLFNSATPVFSAAILLRVVLLFYGLYQDAHSPMKYTDIDYFVFTDAAKFVSQGRSPYD
RATYRYTPLLAWLLVPTAWGGSFWFAFGKASFALADIVAGWLIVRVLRQQRRMQMDMPRA
LKYASIWLLNPMVATISTRGSSEGLLSVMVIALLWAVLEKRVALAGALLGLGVHFKIYPF
IYALSIIWLLEDDESHTEVAVSFSLPSMINCFCSFLNPSRILLTLTSLSVFSALNLSMYV
IYGLPFMQHTYLHHLTRVDHRHNFSAYNMLLYLSSSAAAQGTSSGNGLESLAFIPQLVLS
AVLIPIVLAKKDIAGTMLAQTFAFVTFNKVCTSQYFLWYMIFLPLYLPYSSFMKRPLIGI
SALAFWISGQALWLYPGFLLEFYGLSTFTPGLFLASLSFFLVNIWILAIIVADVGSRPGS
SVTLRAKGVASVGKSSTRARK

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	136	410	5.4e-91	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	3.24e-86	14	411	14	415	GPI mannosyltransferase
252941	Mannosyl_trans	1.32e-66	136	411	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62928.1|GT50	7.69e-242	1	428	1	428
QSS74503.1|GT50	3.12e-241	1	428	1	428
QSS50664.1|GT50	8.94e-241	1	428	1	428
QKX64577.1|GT50	1.28e-178	1	427	1	427
QRD92382.1|GT50	2.49e-177	1	414	1	410

PDB Hits     

OJD25612.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	5.12e-177	1	414	1	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	7.85e-176	1	415	1	429	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	1.49e-171	1	415	1	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	2.42e-157	5	425	7	418	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	4.10e-154	1	415	19	486	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000001

TMHMM  Annotations     

Start	End
10	28
69	86
90	107
168	190
221	243
264	282
292	309
321	343
358	380
392	414