CAZyme Information: OJD24984.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD24984.1
• CAZy Family: GH89
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1J9Q935]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		63211.50	5.7165

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01000452:12011-14270(-)

Full Sequence      

MTDSYDFVIVGGGTAGLLFATRLATALPESSVVVLESGSAFPDNSHLCKYDRYHAWYRPD
LDFGYLTTPQTSLKGQVLSYFRGKGPGGCSNVNFLTYLRGAGEDYNFWAELVGDESWKWE
HTLRRFKEIETFHPGLSEDMNKYSNPLPEYHGYDGPLYVSLPAQLETGMMELFDATARYG
LPLNTDPNSGNPIGMSIPPSTTYKSYRWTSESIYTNYRPANLKMITDIKIAKVIFANKVA
VGVETVGGRKFTANQEVILSTGAFDTPKILLLSGIGPTQELAQHNIETIHDLPGVGKSLS
DHPLVVIGASCAPGAGLSDRAKFVSDPAAVEAARAQWRRDGTGETNLHQSCIITGWLKEN
SILTTNEYQNLDALTKKHLAKDSVPHYETILAGPHFPPTYVIPEGTSYISIVVCLMNMQS
KGKVALKSANATDHPVIDPNYMSHPFDRKMLTLAIRETMKFFESGAIVQEFKEYVLAPKS
QSDEDIREFIDENLLPVFHANGTVKMGKSDDPTACTDKDFRVYGVEKLRVVDLSVCPMTP
NNHSQPTAYLVAQTAAEKVIAEYGGQVNGSVEVN

Enzyme Prediction     

No EC number prediction in OJD24984.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	560	4.4e-146	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.02e-93	1	559	2	531	choline dehydrogenase; Validated
225186	BetA	1.05e-87	1	567	4	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.91e-34	419	555	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.32e-26	4	569	55	586	Protein HOTHEAD
366272	GMC_oxred_N	3.62e-22	71	303	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS73506.1|AA3_2	0.0	1	566	1	566
QSS48722.1|AA3_2	0.0	1	566	1	566
QSZ30159.1|AA3_2	3.30e-144	3	563	7	585
QRC97674.1|AA3_2	6.43e-144	1	564	1	564
QDS72994.1|AA3_2	1.60e-137	5	564	3	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	8.76e-61	5	562	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.24e-60	5	562	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	8.37e-56	5	563	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
2JBV_A	7.02e-51	5	566	14	533	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	7.02e-51	5	566	14	533	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A075TRK9|PATE_PENEN	1.06e-68	3	565	50	626	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	1.47e-68	3	556	49	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	5.56e-67	4	559	40	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.27e-66	5	560	2	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	1.59e-63	3	557	41	571	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000003	0.000053

TMHMM  Annotations     

There is no transmembrane helices in OJD24984.1.