CAZyme Information: OJD24371.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD24371.1
• CAZy Family: GH55
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		54504.10	5.1524

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01000576:2509-4366(-)

Full Sequence      

MSTTTSKLPSDFLWGFATASYQIEGAIEADGRGPSIWDTFCNIPGKIADGSSGETACDSY
NRTSEDIALLRSCRAAAYRFSLSWSRIIPLGSRNDPVNEEGLQHYVKFVDDLIAAGITPM
VTLLHWDLPDELHKRYGGYLNKNEFVADFARYARVVFKALSPKVKYWITFNEPWCSSILG
YNTGQFAPGRCSDRSKSAEGDSSREPWIVGHNLLVAHGAAVKIYREEFKVRDGGQIGITL
NGDWALAWDSENLVDAEAANRKLEFSISWFADPIYFGKYPDSMLKQLGDRLPTWTEAERA
LVQGSNDFYGMNHYCAHFIKNRTGEPALDDFFGNIESSVEDKNGNSVGPETQSKWLHPYP
LGFRKLLKWLSDRYGRPKIYVTENGTSVKGESYMPLAQLLDDEFRVEYFRGYIGAMADAY
ALDNVDVRAYMAWSLMDNFEWAEGYITRFGVTYVDYEGGQKRYPKKSAREIGNIFDAYIE
KS

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	475	6.2e-158	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	2.11e-176	8	469	5	442	Glycosyl hydrolase family 1.
225343	BglB	1.04e-134	5	469	1	444	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	2.92e-111	6	468	28	473	beta-glucosidase
215435	PLN02814	2.30e-108	4	468	24	473	beta-glucosidase
215539	PLN02998	5.53e-98	1	468	24	478	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12207.1|GH1	6.34e-290	2	482	3	483
BCS00431.1|GH1	6.34e-290	2	482	3	483
QEV81508.1|GH1	7.11e-289	2	481	3	482
CAK47813.1|GH1	7.11e-289	2	481	3	482
AGC10824.1|GH1|3.2.1.21	5.83e-288	6	482	7	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	1.83e-261	7	481	25	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	2.07e-238	8	481	3	465	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	2.28e-235	8	481	3	465	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	4.54e-235	8	481	22	484	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	3.95e-233	8	479	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	1.99e-193	6	482	9	478	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	1.59e-173	4	480	2	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	4.91e-147	6	474	31	501	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|B8AVF0|BGL12_ORYSI	1.48e-139	7	468	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1
sp|Q7XKV4|BGL12_ORYSJ	1.48e-139	7	468	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999949	0.000105

TMHMM  Annotations     

There is no transmembrane helices in OJD24371.1.