CAZyme Information: OJD23619.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD23619.1
• CAZy Family: GH43
• CAZyme Description: Chitin synthase [Source:UniProtKB/TrEMBL;Acc:A0A1J9QTR8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1295		143204.43	8.3744

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01000748:1468-5613(+)

Full Sequence      

MDPFTSSHDRPAPPMYDEEPPSYAYPGEPSVLDASGDNMAASTPAIVRSNASMRLLPSGE
SNLGSGGNDASDLGSAGRFRTRQNPPSRQQYVTLREDSPAFNICTPTSASLKGFPRPALV
KGKSTEDRVQPTQDKVAPSSGPDPSLRHVPIASTSEALDLPTIPPTSKKKLRVTWNDESL
EQKRSPTQGGLGRTKTIFRRKPRVSDMVPEPLRLASPKPPAHLLPKRADSLTKSITLSSL
EKQLKAQQFPNSEQPKSDILTDNVRIRSPISMVRSSPQRYHPLYQQSASTSSLPPSRPSS
SLGQAPSMLPSDSVVDGPHLPRRSGSQTRPWTPSRGSEWSRPHAPPSVSSVNYEPPDING
NPRPGTPSSRYGGSPRRPLPPAPLFTGAPASTSGETSIDIADGDGDGDVDDDVDDPFGGG
GRTINQRNDTRASVQSFESYATDFTVVTDEKDVMSKVDLDDDEDEEANLNVHYGPAPTGR
QERRGVRKAQMTKKEVRLINGELILECKIPTILHSFLPRRDDREFTHMRYTAVTCDPDDF
TVRGYKLRQNIGSTMRETELFVCVTMYNENEIDFTRTMHGIMRNITHFCSRTKSRTWGKD
GWQKIVVCIIADGRQKVHPRTLNALAAMGVYQDGIAKNIVNQKPVNAHVYEYTTQVSLDP
DLKFKGAEKGIMPCQIIFCLKERNEKKLNSHRWFFNAFGRALTPNVCILLDVGTKPAPTA
LYHLWKAFDQDSNVAGAAGEIKAGKGKGWLGLFNPLVASQNFEYKMSNILDKPLESVFGY
ITVLPGALSAYRYHALQNDSTGHGPLSQYFKGEMLHGKNADVFTANMYLAEDRILCWELV
AKREEKWVLKFVKSAVGETDVPDSVPEFISQRRRWLNGAFFAAVYSLIHFRQIWRTDHTI
PRKILLHIEFVYQFVSLAFTFFSLANFYLTFYFIAGALSDPTNDPFGHNIGKYIFVILRY
ACVLLICLQFILSMGNRPQGAKKMFMTGMVVYCIIMIYTVFSALYMVVTQLKLSDQPLEE
RLKLGNNTFTNIIVSTLSTVGLYFFMSFLYLDPWHMFTSSAQYFALLPSYICTLQVYAFC
NTHDVTWGTKGDNIIHTDLGTARTTGSSTVELEMPSEQLDIDSGYDEALRNLRDRLEVAP
PELSEAQMQEDYYRAVRTYMVSVWVVANAILAMAVSESFTEKSAGNNGYLAFVLWSVAGL
ALFRALGSGAFAMLNLVHQIMEGKMKFEAAGGTGYGYGGGLLGAAGSSAGAGSSGAGSSV
GRTSAGRSVGETVSDWASEAGWTVKRTAGKLRFWR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	566	728	2e-78	0.9938650306748467
GT2	706	896	4.4e-22	0.35294117647058826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	2.33e-112	566	728	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	3.89e-95	562	882	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	1.87e-33	495	565	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	2.27e-30	677	1013	115	411	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	6.20e-21	707	1005	205	479	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62838.1|GT2	0.0	1	1295	1	1200
CAA70433.1|GT2|2.4.1.16	0.0	246	1295	2	1043
AAK07645.1|GT2	0.0	208	1295	8	1063
QRD92110.1|GT2	0.0	345	1295	150	1072
BAE65446.1|GT2	0.0	345	1295	88	1010

PDB Hits     

OJD23619.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30584|CHSA_EMENI	0.0	345	1295	86	1012	Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsA PE=3 SV=2
sp|P30600|CHS1_EXODE	0.0	509	1228	211	936	Chitin synthase 1 OS=Exophiala dermatitidis OX=5970 GN=CHS1 PE=3 SV=2
sp|P30589|CHS2_NEUCR	0.0	353	1228	170	1062	Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-2 PE=3 SV=4
sp|Q92444|CHS2_PARBR	0.0	246	1295	2	1043	Chitin synthase 2 OS=Paracoccidioides brasiliensis OX=121759 GN=CHS2 PE=3 SV=2
sp|P87073|CHS1_PHYB8	1.50e-296	470	1216	86	838	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000001

TMHMM  Annotations     

Start	End
875	894
914	936
956	975
987	1009
1029	1051
1158	1180
1195	1217