CAZyme Information: OJD22119.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD22119.1
• CAZy Family: GH17
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A1J9R0W4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468		50839.12	4.3621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01001165:7124-8677(+)

Full Sequence      

MKVEKIWAVLAATAGIGIRVVNADDDDLSVGSLDSTKAAATAITRGAARYYRGNEPGESP
GILPSPYTWWHSAVLFGTLVDYWHFTGDSSYNDMIKQGLLAQAGQNQDYQPANQSAGLGN
DDQAQWGLAALSAAEFSFDARSDEWAGFARRVFQTQVRRWNDEKCRGGLNWRVNSFSNGH
SVKNSMSNGAFFELSSRLARHTNNETYAEWATKAWDWMSDIGLLTDDFKVFDSADGNTDC
KEINERQWSVNVGSLLSGAAHMYNMTNGDSTWKSRVEGLFKGASIFFKRDIMFEPACEPD
EKCDIEQKTYKAILSKALRNSMQLCAFMNDLVLPKIEASAREAADECDEENGYHMCSYDW
VDVDNDRDDDDDNDDDDETLGDQLSALQIVLAKLAGMGEGALPGRQSSPGGSPGGSPGGS
NSGGTPTNGAPPSASSPNAALSVMHLGIRQWAAIVGMTGFVAILANVM

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	394	1.2e-86	0.9301675977653632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	6.35e-134	35	358	1	328	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.001	38	253	5	212	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP74717.2|GH76	7.68e-157	4	403	3	406
ABF93408.1|GH76	7.68e-157	4	403	3	406
ATZ53339.1|GH76	4.26e-112	1	394	1	386
CCD44408.1|GH76	4.26e-112	1	394	1	386
APA11655.1|GH76	6.02e-112	1	394	1	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.42e-75	50	360	50	373	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]
6SHD_A	2.28e-08	67	272	86	278	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.88e-07	67	272	87	279	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	9.05e-07	67	272	87	279	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4C1S_A	1.15e-06	149	266	133	252	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	4.00e-85	35	394	29	384	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	4.88e-82	8	390	10	383	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q05031|DFG5_YEAST	1.00e-79	27	390	28	388	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	3.98e-79	27	391	20	379	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	6.08e-79	2	391	5	382	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.681157	0.318836

TMHMM  Annotations     

There is no transmembrane helices in OJD22119.1.