CAZyme Information: OJD21817.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD21817.1
• CAZy Family: GH16
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A1J9PZR3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
918		99755.95	5.2761

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01001270:3492-6577(-)

Full Sequence      

MAMRHFPAAHALPCRLNYQCVVDIDQANDLSFSPITQVPTATVAAQDSDTTGTYFTQLES
DVRTYSQPFPTEISYIVFEDHIGLLHPGVPHLDSVPSALLSSNSNCYYRGYLCPGLPHVE
ETRIANWLLSPSTGSVNADISIGITIGPSPPFQSPTAGCSPPYPITSSKSSTLAPIVPSP
SSSKPTVTPSPKPPSMSGQNIFEPINRDPIPQNIPSRDDHPLKRDNISDTQGPVHTNKFY
ANFFIGSQANYGFVQPYAVGWAKGTGSVKSYGLTISHTEANQLAFGPKNSKIPGEPVQFY
INPIGIQSMILSAAEIGDSTVLTVSKPLAFSAEITLRPNRDSDSNITFPLVQGMGYVTGV
YTNLQPVIQSGVFFRQLESVPSPKPGIFKYKVALEDNTNWLIYVASADSADPKLKLENNG
LINGPAGFSGAIQVAKNPNGGPGETVFDGSAGVYPVAGNVTGSVVSQDATGTYKLTWEKD
GKDVDSTPLLMFALPHHVQSFDSETQGRKADLLLRTTTKGMATAVVADSWTMVENALPIQ
MGFAPWNPAGTSVTLSRPAKQTLKDVAPNELSQDIHQQTNLNSMYFSGKAFAKFAMVVYA
VRELAQDAPLSESAFNTLKDAFATFVNNKQQLPLVYDNVWKGIVSSGTYETGDPGLDFGN
TFYNDHHFHYGYFILSAAIIGSLDPSWIDANKAWVNALVRDAANSVSDDPLFPFSRGFDW
YNGHSWAKGLFESIDGKDQESTSEDTMFAYAVKMWGKVVKDPSMEARGNMMLGILARSLN
NYFLMKSDNVNQPPNFTSNKVTGILFENKADHTTYFGSNLEYIQGIHMLPIIPSSAYTRH
KDFVREEWDAMFSESASTPASKVQGGWQGVLYSNLALIDPDASWNFFAQEPFDLAKIDGG
ASRTWYLAYAAGLGGGPH

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	221	909	3.5e-229	0.9887459807073955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	554	907	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	154	917	16	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.50e-157	220	548	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67487.1|GH81	0.0	194	917	126	850
QSS66079.1|GH81	0.0	192	917	126	852
QSS57493.1|GH81	0.0	194	917	126	850
ABH10633.1|GH81	0.0	196	917	1	718
QRD82801.1|GH81	0.0	197	915	192	909

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.28e-105	198	911	5	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.31e-105	198	911	30	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.67e-102	198	911	5	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.70e-26	517	890	255	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5T49_A	1.43e-20	664	903	461	696	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	68	912	74	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.51e-175	200	917	2	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.77e-161	200	913	46	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	2.07e-157	200	912	427	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.35e-153	200	913	401	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OJD21817.1.