CAZyme Information: OJD20585.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD20585.1
• CAZy Family: CE4
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1J9PW65]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	LGTZ01001798|CGC1	35415.88	5.5446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01001798:4866-6086(-)

Full Sequence      

MFGHVDFVIKAAPGRGIVSSAVLQSDTLDEVDWEWLGVDNARVQTNYFGKNQQGTFDRGQ
FHGNPGNQDGYHTYSLDWTSDRIVWQIDGQIVRTLTAADAGASYPQTPMQVKAGVWAGGD
PTNAPGTIEWAGGPTDYAAGPYVMGLKSIAVTDYSTGIKYRYTDRSGNWQSIESVGGKVN
GHGTPGSGQQVESSIPPAEATRPPPTKGIIHPSGYPWVPSTTHKPESTPSITSYPGLPSD
WIVTDSGRASMPSTASRTSQPSSQSSPSSSAFSSAHGPESSPSITKTGFVTSPPITPSSS
ATDSPDATVAPGTGAANGNVRISYGVAAMYALIGAVLAF

Enzyme Prediction     

No EC number prediction in OJD20585.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	1	133	4.6e-60	0.8481012658227848

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	6.06e-88	1	155	46	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	3.25e-46	1	132	32	168	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	6.37e-19	1	152	66	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.02e-17	2	135	68	196	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185685	GH16_XET	2.55e-14	1	143	47	192	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67372.1|GH16_18	7.48e-174	1	339	92	414
QSS57604.1|GH16_18	4.30e-173	1	339	92	414
QDS71653.1|GH16_18	5.33e-93	1	253	89	349
QRD81674.1|GH16_18	7.57e-92	1	256	89	352
UDD55146.1|GH16_18	7.57e-92	1	256	89	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	2.09e-65	2	173	70	243	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
5SV8_A	5.81e-12	29	116	88	171	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
3D6E_A	1.79e-11	2	132	59	181	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
1CPM_A	2.18e-11	2	181	14	183	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]
1GBG_A	2.96e-11	2	132	72	194	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALQ5|CRH11_ARTBC	9.27e-80	1	273	85	369	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|Q5AFA2|CRH11_CANAL	4.37e-63	1	181	90	269	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1
sp|Q8J0P4|CRF1_ASPFU	5.64e-63	2	176	91	267	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|P53301|CRH1_YEAST	1.72e-60	1	181	105	284	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|D4B4J2|CRH12_ARTBC	4.49e-57	2	177	97	274	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OJD20585.1.