CAZyme Information: OJD19738.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD19738.1
• CAZy Family: GT62
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		43240.97	8.4516

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000005:186292-187599(-)

Full Sequence      

MKTGIFSITTLSLLAVASALPQPHRPQNAKRETSTNYVVVDVPEVVVWVNQNGKPVRTDT
KGVVSTYAAPTTSAIQDTPSPKDPSARNTLPLGPQPPQPPPSADAPMVPGGGKSNIVNLS
YLPVPLPLPSKTSTPKPPSPPNEHGVSDLPTKGVGVCYSPYRSDGRCKSEKEVDDDFSKL
GKYNVIRFYGVDCDQVPKIVAAAKKHNKKLFAGIFDINDLDNGLQTLIDAAKSSWSIITT
VSIGNELVNSGQASAGAVVKAVNTARSKLRAAGFQGPVVTVDTFVALIANPELCKASDYC
AANCHAFFDPNTDASHAGAFVKEQMKRVSAAAGGGKKTIITESGWPKSGQSNGKAVPSKK
NQELALQSLMDVFADDDEAGLFLFSAFDDNWKKDNAGTFGAEKFWGIL

Enzyme Prediction     

No EC number prediction in OJD19738.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	154	407	1.1e-24	0.954983922829582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.35e-74	155	408	47	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS69160.1|GH17	1.23e-137	1	408	1	407
QSS51160.1|GH17	7.02e-137	1	408	1	407
QSS63389.1|GH17	5.45e-124	24	408	5	388
CAK47997.1|GH17	7.64e-102	147	407	99	360
BCS13276.1|GH17	3.48e-100	155	407	111	360

PDB Hits     

OJD19738.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	1.44e-76	155	407	128	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53334|SCW4_YEAST	7.97e-75	146	408	126	383	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	9.61e-74	155	408	138	386	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53189|SCW11_YEAST	1.31e-38	156	408	284	538	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|A1C499|BTGE_ASPCL	3.73e-36	154	408	309	561	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999745	CS pos: 31-32. Pr: 0.6334

TMHMM  Annotations     

There is no transmembrane helices in OJD19738.1.