CAZyme Information: OJD18646.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD18646.1
• CAZy Family: GT3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544		60351.41	6.5036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000029:57705-59594(-)

Full Sequence      

MKVLPQSAAVLAALACQHCNCAVASPNPKDDPASLAQACPDYLKYSMVKHGPYSEGPLKL
PFQRPVEACRTFSSPLVEQVIEDVTSRMVDKDLAQLFRNAFPNTVDTTVRWHVTGIEPRS
KTSRQYPQGENWQGPHSFIVTGDINAEWLRDSTNQLTQYQALATKDPKIKSLILGAINTQ
VEFVLQSPYCNAFQPPPPSGLKPVPPTQKDTVHPAYEKSVVFECKYELDSLANFLALGNK
FYAETKSVDFISDRWYSAVDTVLRVIQEQSEPTFNEDSQYVRNEYTFIRMTEVGTETLNL
GGIGNPLNNGTGLVRSAFRPSDDATTFGYLIPSNAQMAVELKRTADTVKAAGGPHRLVKA
LLTRANIIEEGIRKHGVVSHKKFGDVYAFEVDGYGSRILMDDANLPSLLSLPLLGFVDKN
DPIYENTRKMILSKDGNPYYLTGSAFHGIGGPHIGVKNAWPMSALVRARTSDDDEEITES
INMVRNASLLGLIHETVDVNNLTDYTRSWFAWANSVFAQTILDLAERKPHLIFGKDAKPY
KVGQ

Enzyme Prediction     

No EC number prediction in OJD18646.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	90	522	1e-161	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	90	522	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	3.00e-151	68	531	1	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS68485.1|GH125	8.81e-309	1	544	1	542
QSS49978.1|GH125	1.25e-308	1	544	1	542
QSS59948.1|GH125	2.06e-307	1	544	1	542
QVM13217.1|GH125	3.70e-277	10	542	7	545
BAE61251.1|GH125	7.53e-269	7	542	5	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	2.02e-98	64	524	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	4.94e-98	64	524	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	7.29e-91	64	524	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	3.32e-79	76	523	11	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	1.82e-78	76	523	11	421	Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	6.59e-183	37	532	25	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.021466	0.978516	CS pos: 24-25. Pr: 0.8850

TMHMM  Annotations     

There is no transmembrane helices in OJD18646.1.