CAZyme Information: OJD15315.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD15315.1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477		54301.76	6.0275

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000164:49061-50494(+)

Full Sequence      

MPLQVTERDVFKSIQLSYQYLLLHFIMKYFPRFAFFTVLWLKAGAKEGPPGETTKDGSDY
LDKASDRCDCYVVSGPEPGYFQNYKFYDFRSVSPEKTWLSNSKTTRPSLTKTGNPKKAFR
MNLEDTGFLDDWAIQDWSRPGSDLFPIPIRNYYENVFVLEDTTNNTTNTTYLALRTQRLQ
NHTSTAEIETYSHDYFRCSLRVRLRLHAGRSGHLEDGDGSEFDEEAIPSKGRNHSKLGPA
NFRLHPPPTGAVAGIFTYHSVNVESDIEILTADPPTLIHYSNQPDWDPSTDLMIPGASTI
AKLPVPWTSWSAHRLDWFPTMTRWYLNNTLQDAKNYRVPDQPSMLALNLWSDGGEWSGNM
TIGSTVLMGIEWIEVAYNTSTKDGLFDEFNRTRRPGHLGASGHNHPKWILKDRMVRKIKP
RGGKPKNDLKKVDDYDEGGGGDDGDSDTNKEHLQCLIGCRIDDVETVGVPEILWDYS

Enzyme Prediction     

No EC number prediction in OJD15315.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	130	375	6.3e-78	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.82e-38	126	375	7	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS58825.1|GH16_22	3.62e-225	27	476	1	446
QSS53837.1|GH16_22	5.14e-225	27	476	1	446
QSS75565.1|GH16_22	1.47e-224	27	476	1	446
QQK40468.1|GH16_22	2.78e-90	68	381	40	375
CAP95204.1|GH16_22	5.32e-88	68	420	80	459

PDB Hits     

OJD15315.1 has no PDB hit.

Swiss-Prot Hits     

OJD15315.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000030

TMHMM  Annotations     

There is no transmembrane helices in OJD15315.1.