CAZyme Information: OJD14455.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD14455.1
• CAZy Family: GH18
• CAZyme Description: Glucoamylase [Source:UniProtKB/TrEMBL;Acc:A0A1J9QE95]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	LGRN01000218|CGC1	69705.90	7.0320

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000218:6130-8269(-)

Full Sequence      

MAGTFILRGAWWLSLSWVVIAAPQDPFQAPRATGSLDAWIAKESPYALQALFANIGADGV
KVKGAAAGIVVASPSKSEPNYFYTWTRDAALVLKSLVDAFIAGNTSLQPKIHEYINAQAH
LQGISNPSGDLSTGGLGEPKFAVNMLPFNGDWGRPQRDGPALRATAMIAYAKWLVANGYT
DTVKSIVWPVLQNDLSYVAQFWSSSGFDLWEEVKGMSFFTTAVQHRALVDGGRLARQIGY
ECPHCESQAPQILCYMQNYWTGSYINSNTGTDRSDRSGIDANSVLAIIHTFDPEASCDDL
TFQPCSAKSLANHKALTDSFRSIYAVNSGIRAGSGVAVGRYPEDIYFGGNPWYLSTFAAA
EQLYDAIYQWQHIGSISITEVSLAFFKDVHSSAAVGTYSSSSATFKSIIGAVRNYADSYL
AVAQKYTPESSELAEQYSRKDGTPLSAADLTWSYASFLTAIARRNSSVPDPWGQTAATSI
PATCQTTSAKGSYGTATNTKWPADLTSKPRRAPTSTPATSTHTTVTSTTTSTSPCVTPDS
IQVTFNEIVTTSPGQSVFVIGSVPELGSWVVESAAALSADKYTDGNHLWHRTIKLRAGLS
FEYKYIRTEAGRSVVWEGGPNRSYRVPKGCNIYNDKREDYWR

Enzyme Prediction     

EC	3.2.1.3:94	1.14.99.55:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	58	461	2.5e-78	0.9667590027700831
CBM20	541	630	1.1e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	4.88e-134	47	461	3	416	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
99886	CBM20_glucoamylase	1.49e-43	535	630	1	96	Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain. Glucoamylases are inverting, exo-acting starch hydrolases that hydrolyze starch and related polysaccharides by releasing the nonreducing end glucose. They are mainly active on alpha-1,4-glycosidic bonds but also have some activity towards 1,6-glycosidic bonds occurring in natural oligosaccharides. The ability of glucoamylases to cleave 1-6-glycosidic binds is called "debranching activity" and is of importance in industrial applications, where complete degradation of starch to glucose is needed. Most glucoamylases are multidomain proteins containing an N-terminal catalytic domain, a C-terminal CBM20 domain, and a highly O-glycosylated linker region that connects the two. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
395557	CBM_20	5.32e-31	541	631	1	90	Starch binding domain.
99883	CBM20_alpha_amylase	5.19e-25	541	642	1	95	Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain. This domain is found in several bacterial and fungal alpha-amylases including the maltopentaose-forming amylases (G5-amylases). Most alpha-amylases have, in addition to the C-terminal CBM20 domain, an N-terminal catalytic domain belonging to glycosyl hydrolase family 13, which hydrolyzes internal alpha-1,4-glucosidic bonds in starch and related saccharides, yielding maltotriose and maltose. Two types of soluble substrates are used by alpha-amylases including long substrates (e.g. amylose) and short substrates (e.g. maltodextrins or maltooligosaccharides). The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
119437	CBM20	1.51e-22	542	631	1	89	The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67842.1|CBM20|GH15	0.0	26	642	33	646
QSS49369.1|CBM20|GH15	0.0	26	642	33	646
QSS60609.1|CBM20|GH15	3.75e-288	26	642	76	617
CAC28076.1|CBM20|GH15|3.2.1.3	7.53e-269	29	641	25	617
ABH92242.1|CBM20|GH15|3.2.1.3	7.53e-269	29	641	25	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FRV_A	2.29e-231	35	642	2	616	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]
2VN4_A	7.20e-221	35	641	1	597	Chain A, GLUCOAMYLASE [Trichoderma reesei],2VN7_A Chain A, GLUCOAMYLASE [Trichoderma reesei]
6FHV_A	3.13e-208	34	641	6	592	Crystal structure of Penicillium oxalicum Glucoamylase [Penicillium oxalicum 114-2]
1AGM_A	1.42e-205	35	503	2	467	Refined structure for the complex of acarbose with glucoamylase from Aspergillus awamori var. x100 to 2.4 angstroms resolution [Aspergillus awamori],1DOG_A REFINED STRUCTURE FOR THE COMPLEX OF 1-DEOXYNOJIRIMYCIN WITH GLUCOAMYLASE FROM (ASPERGILLUS AWAMORI) VAR. X100 TO 2.4 ANGSTROMS RESOLUTION [Aspergillus awamori],1GLM_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori],3GLY_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori]
1GAH_A	1.47e-205	35	503	2	467	GLUCOAMYLASE-471 COMPLEXED WITH ACARBOSE [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36914|AMYG_ASPOR	7.07e-251	31	642	26	612	Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=glaA PE=2 SV=2
sp|P0DN29|AMYG_ARTBC	4.39e-244	14	642	5	610	Glucoamylase ARB_02327-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02327-1 PE=1 SV=1
sp|P22832|AMYG_ASPUS	3.73e-235	31	642	24	639	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1
sp|P23176|AMYG_ASPKA	6.99e-233	31	642	24	639	Glucoamylase I OS=Aspergillus kawachii OX=1069201 GN=gaI PE=1 SV=1
sp|P69327|AMYG_ASPAW	1.92e-230	31	642	24	640	Glucoamylase OS=Aspergillus awamori OX=105351 GN=GLAA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000368	0.999628	CS pos: 21-22. Pr: 0.9817

TMHMM  Annotations     

There is no transmembrane helices in OJD14455.1.