CAZyme Information: OJD14192.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD14192.1
• CAZy Family: GH18
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1J9PCC2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	LGRN01000236|CGC1	69417.05	8.7912

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000236:6850-9076(-)

Full Sequence      

MLLSFLPSGNVRASWCALLLLASFATSSVLVHDNQKRTGFARDEYDYIIVGGGLTGLVAA
HRLSENLFVSVLVLEYGVIDRSNKTLIPYSATSLNVPAMFDIRTAPEPGLGGNTYAVRAG
SVAGGGSTVNGMAYDRASAADYDSWEELGNRGWGWKGMFPYFRKSADFTPPKKAVVDKYK
YTFDETAYGRHSPLQVTFPDWQVPDQYKMADAFTELGISSVKEHANGNAIGQFWAPATID
AKTMTRSSSLTAYYDTVSWRPNLKMLTEHKVIELTFEGNSAVVSGVKALDRKANKQVTFR
ARKEVILAAGTLHTPQILQLSGIGPKSVVEAAGIKSRVDLPGVGSNLQDHPVAYLNWKVT
NSFPEPNIMTTNQTFAAAALDEYQKYRTGPYTKAQSNSIAFLSLPMITDNTKVLIDNLKA
QVSSTYLPEVYSSELLAGFEAQRKILARQLGDGCVSALEFPFGGSGGVPNSIQKPLSRGT
VHLNASNPHGEPIVRYNAFTNPFDRAQMATFIAFTRRYFKTNALVDMQPQEVSPGEDAKT
EDEIIAKLIAGGPLSLSPSFAHPSSSCPMMPRDKGGCVSPELRVYGTKKLSIIDASIIPI
IPSAHLQATMYAIAEKASDIIKWRGWWQWWLTPFA

Enzyme Prediction     

No EC number prediction in OJD14192.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	44	622	4.8e-168	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.89e-67	44	624	5	534	choline dehydrogenase; Validated
225186	BetA	1.03e-64	44	622	7	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	8.77e-31	45	352	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.33e-26	475	617	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.36e-17	22	590	38	545	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS75262.1|AA3_2	7.00e-316	132	629	1	498
QSS59059.1|AA3_2	3.31e-242	209	619	1	411
QDS77604.1|AA3_2	4.65e-210	10	625	2	614
QRC97861.1|AA3_2	2.77e-171	28	625	3	601
QRC90410.1|AA3_2	2.99e-171	44	622	29	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	1.94e-120	22	621	12	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	7.97e-111	45	622	6	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	2.45e-69	45	622	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.57e-61	44	622	1	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6XUT_A	3.64e-61	45	622	17	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	8.63e-106	44	622	37	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	4.07e-77	23	621	21	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	4.07e-77	23	621	21	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	5.13e-69	36	622	5	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	5.13e-69	36	622	5	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.395711	0.604281	CS pos: 27-28. Pr: 0.5297

TMHMM  Annotations     

There is no transmembrane helices in OJD14192.1.