CAZyme Information: OJD13563.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD13563.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		44189.57	9.4687

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000289:30710-32250(+)

Full Sequence      

MRKGYLIFIIVNFLIVAFLVRSVFTLLTLLIEDASADAIRRSDLPSPNSSLIESRPQIIP
KIIHQTYKNDSIPAVWQDAQRSCVLLHEDYEYKLWTDEKSREFIASEYPWFLETFDNYPH
NIQRADAIRYFVLAHYGGTYIDLDDGCNRRIDPLLSYGAWVRRTAPTGISNDAMGAIPQH
PFFLRVLDSLQAYNKNWALPYITVMYSTGPLFLSVIWKEYMLSEPAMADRVRILMPDEYN
RHSWSFFTHHQGSSWHGRDARLIFWMGGHWMLLTTAGFLLAGILGFCLWWAYGRLLFYTS
RCYRYSPLSRRPPPPPPHPPIPQRSSSFSPSRRHGGRLFPGWLRRQSPAKRRGDEEAGNG
GRYTDVAYELLGGRKAGSIRNE

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	8e-24	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.24e-76	1	286	10	311	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.44e-24	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS66595.1|GT32	5.08e-258	1	382	1	379
QSS73535.1|GT32	6.91e-256	1	382	1	379
EAA57874.1|GT32	6.69e-181	1	374	1	354
AAP47108.1|GT32	6.69e-181	1	374	1	354
BCS17906.1|GT32	2.81e-180	1	370	1	351

PDB Hits     

OJD13563.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.94e-101	1	302	1	300	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	6.05e-99	1	302	1	292	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.67e-89	37	286	56	312	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.67e-86	48	279	46	278	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.50e-54	59	288	64	295	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.639858	0.360142

TMHMM  Annotations     

Start	End
5	27
270	292