CAZyme Information: OJD13270.1

Basic Information

• Species: Blastomyces percursus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces percursus
• CAZyme ID: OJD13270.1
• CAZy Family: AA4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43673.69	6.1688

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BpercursusEI222	10384	N/A	99	10285

• Gene Location: location=LGTZ01002497:2304-3521(+)

Full Sequence      

MRASRLGRPISVCLLLWLLMSSFFVFKASQSKQIVFNRPTERWGMDLGAGCPPHIAAPSP
DPNMDPKLARPLSAAELLCRPLPSDYSSVPKLLHQSWKTNELPAKFEKWSRVCREKNPDW
EWVLWTNDDNLNLVRQYFPWFEEAYLELPGDIYRADFSRNLYMYLFGGVYVDLDTDCLRP
ISAVFEAFDIPNSENTTVAAAADGNHITQFAVFGRMGTNNDFDNSIPNAWMASSPGHPFY
LMPPFSVLPKIAKDKSYISWLFQQVSAEKWTGPVALYNAILDFNTNGLSKEAASLAAVGP
FASLAKESKQEIILLPSHWIYPYDWTVKELQPVCSAETETFDAKACRERLEVDKKGGISI
TYWSHTHDNKKDNVKNIDRLNRND

Enzyme Prediction     

No EC number prediction in OJD13270.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	108	184	7.2e-17	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.76e-23	89	280	82	240	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.41e-15	113	181	11	83	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ71055.1|GT32	5.27e-104	49	380	57	370
ANH56535.1|GT32	5.32e-100	49	382	67	378
QLI72987.1|GT32	1.61e-85	55	377	34	358
AEO66576.1|GT32	5.11e-79	69	380	78	410
BCS29894.1|GT32	9.83e-60	52	366	53	379

PDB Hits     

OJD13270.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	8.28e-21	87	181	55	149	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.33e-20	83	304	58	291	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	4.74e-18	89	184	82	177	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	2.90e-17	89	274	62	214	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	2.49e-16	89	276	55	209	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.521817	0.478178

TMHMM  Annotations     

Start	End
7	26