CAZyme Information: OJD12890.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD12890.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572	LGRN01000355|CGC1	60288.29	6.9629

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000355:18173-20134(-)

Full Sequence      

MKGALFFSAAAAVAGSALGHVGHQQHNAFHQRRAFQPSAPPSDTTYEASPTPTGGYQVSP
IPTVSTPVVPPSYETQPIPSDVSPIPSDTPGHNPDDDDENCGCITKIITYYGEASLVEEK
TTTIRSTSTTTLTVEVTPEPTLPTPVVTVFPTPGTYTIPANTIVVTKETTVCAATSTAVS
PGKHVYGGVTTVVNAPTTVIVDVAVVKPVGKTVTSVIEQTTYVCPSSGTYTIAPSTTSVP
ASTVFVYPTPATYTTGTYTQPAQTVTVTETNYVYVCPAPTGGLPAPKPKSKPQSQPKPEP
QPKPEPKPPALGGGEKWAMTYSPYTDNGQCKGPVAVAADIALIKLKGFRAVRVYGTDCDS
LQNIGNACKLNGLKMILGVFVSNKGIQEAQGQVTDIVKWGNFGMVDLIVVGNEALHQRTA
TADSLVGLLDFAKRTFRGAGYNGPITTTEPLNEWLANGKRFCQHIDVIGANIHCFFNPNV
VASECGNFIKNQMKILGDICPGKDVINLETGWPSGGSNNGKAVASKSAQAAAIKSIIKEV
GSKSVFFSFTNDLWKSPGYLGVEQHWGCGDLF

Enzyme Prediction     

EC	3.2.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.47e-52	310	567	40	299	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
223021	PHA03247	2.34e-04	31	292	2583	2844	large tegument protein UL36; Provisional
282904	Herpes_BLLF1	0.003	38	329	475	744	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS72686.1|GH17	1.69e-223	1	572	1	592
QSS65781.1|GH17	1.01e-204	1	572	1	591
AAL09829.2|GH17	3.39e-166	99	572	38	536
QSS55528.1|GH17	4.29e-153	319	572	1	254
QMW26283.1|GH17	5.87e-114	1	572	1	601

PDB Hits     

OJD12890.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1C499|BTGE_ASPCL	4.11e-120	1	572	1	564	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q2US39|BTGE_ASPOR	1.04e-114	1	572	1	601	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	1.04e-114	1	572	1	601	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	1.67e-109	98	572	42	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	1.67e-109	98	572	42	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.181359	0.818626	CS pos: 19-20. Pr: 0.7278

TMHMM  Annotations     

There is no transmembrane helices in OJD12890.1.