CAZyme Information: OJD11940.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD11940.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		41302.07	7.1374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000468:3777-4919(-)

Full Sequence      

MQFRLQPPDDFEPGFRKRQLSWRVALRSKHVRGLSFILFIFTGCHLLWVYLRPFAHPRVP
VVTETYPGVDWSRFAYAQYTTEETYLCNSLMIFETLQRLQTKPDRILMYPNSWSTTSGSI
AGMLLKARDEFNVKLRPISVLQASTDKTWGASFTKLLVFNQTDYQRVLSIDSDSTILQSM
DELFLVPSAPVAMPRAYWLQPEKDALTSALVLLEPSDFEFSRITQAIKNKSAHEFDMDVV
NSLYRNHCLTLPHRPYFLISGEFRGNDHSGYLGSGEEEWDPAKVFGEAKLLHFSDWPYPK
PWLDATIDETNNKMPNCSIGLTGEADCRSRNIWLSLYEDFRERRKVASISPSYFSRT

Enzyme Prediction     

No EC number prediction in OJD11940.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	79	304	4.4e-20	0.8599221789883269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	1.23e-78	74	340	1	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	2.32e-17	74	313	1	223	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.61e-11	72	227	69	223	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	2.72e-10	75	302	2	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS69037.1|GT8	2.05e-166	17	345	17	348
QSS51045.1|GT8	1.37e-164	17	345	17	348
QSS63276.1|GT8	2.09e-147	17	323	17	326
QVM12485.1|GT8	3.57e-127	16	345	6	342
QKX63128.1|GT8	7.54e-114	69	348	67	352

PDB Hits     

OJD11940.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	1.04e-95	69	345	150	431	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q4WBL2|GNT1_ASPFU	3.37e-89	24	346	31	372	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q6FQ15|GNT1_CANGA	9.91e-25	69	352	86	492	Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GNT1 PE=3 SV=1
sp|Q6BUZ2|GNT1_DEBHA	1.94e-24	68	302	62	399	Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GNT1 PE=3 SV=2
sp|Q59ZI3|GNT1_CANAL	3.09e-23	67	344	64	456	Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GNT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000021

TMHMM  Annotations     

Start	End
33	51