CAZyme Information: OJD11864.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD11864.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	LGRN01000479|CGC1	52568.07	5.7271

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000479:8630-10009(-)

Full Sequence      

MSNFSSPLGSHMLSSVTKRKVARSARVASWDQKGLNEDAFVVLPGETAVLADIEGPGAIT
HLWFVQTCRKILGPGLIPYSKSGVAMMEVHNALGLNYEVSDPDYYRKVIIKMYWDGSETP
NVLAPIGDFFCVGHSMAANFQSMPFTVSVKPSEEKKFGGSAAFNCYLTMPFNKHARIEIE
NQNDEAYFQYFYIDYELYPNPLPEDTLYFHAHWRRENPTNGWAPPEIQTNSLETQVPNLD
GKNNYVILETEGAGQYIGCNHSVAHFQGTWWGEGDDMIFIDDDTWPPSMHGTGGEDYFSQ
GWGMQKNAYPFCGSIIHEEDVPNYQVSYRWHLADPVHFSKKIKVTLESGHANHLRDDWAS
TAYWYQTLPGPKLDILPVEQRLPRKPEFPPKDDVPGPNLKELDEVRLAKVSQRQERMDAF
VKDRNEWLERRAQDSRQRARNNVEICKDIRRRFLESLKE

Enzyme Prediction     

No EC number prediction in OJD11864.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	105	366	1.6e-81	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	1.05e-116	106	366	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39208.1|GH172	2.14e-309	7	457	2	452
CAP93243.1|GH172	4.84e-309	7	457	2	452
QKX59927.1|GH172	4.72e-300	8	457	5	455
UPK94269.1|GH172	3.82e-295	3	458	2	457
QKD59092.1|GH172	6.76e-292	1	458	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	1.44e-163	16	453	11	446	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	1.77e-52	23	366	20	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

OJD11864.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000079	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OJD11864.1.