CAZyme Information: OJD11602.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD11602.1
• CAZy Family: AA7
• CAZyme Description: Long-chain-alcohol oxidase [Source:UniProtKB/TrEMBL;Acc:A0A1J9P6T2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757		82047.60	8.3870

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000524:8390-10741(+)

Full Sequence      

MASPLSSAPIEILDSPLAPAPAADTILTPLQWKTLLALADTVIPSIRSKSAGGCPSDCMI
NDAEFALAAHHLQSINDASAHSDLAIRFLAENASSVPEFKESMCRVLGQQIPDEARRGIS
VILNALNSRPVALALTGYAAPIQCQPYRVREAIFRGWATSVLPPMRTLYRSLITLFHKAW
IPLSPTLPAIIGFPRVPINFTPAEGFPYEFLQFPPGDNTETIDTDVVIIGSGCGGSVAAK
NIAEAGHNVIVLEKSYYWSEKHFPMTMKEGTLHLFENGGANVSDDGSTAVLSGSTWGGGG
TVNWSASLQTQNYVRQEWAKKGMPFFTSTEFQKSLDRVCDRMGVNTEHVKHNNANRILLE
GARKLGYAAKTVPQNTGNQEHSCGHCTLGCGSCGKKGPQVTFLADAARAGARFIEGFHAE
RILFREGNAGNCLANGVEGTWTSRDINHGVSGEPVIKRKVVIKAKKIIVSCGSLQTPLLL
LRSGLKNPQIGRNLYLHPVILLSAVFREEMKPWEGGILTSVVNEFENIDGHGHGAKIETV
TTIPSVFLPIFPWTDGSNYKRFVSNLRNTAGFITLTRERYGGRVYPDPVDGRCRISYTPS
HFDRKNMMEALIGAAKIAYVCGAQEIHTTSREVPTFIRPERSATESCGPEAGVNHAAFQA
WIKKVRHTYSPLAPERTIFASAHQMGTCRMGTSPKTSVVDPSGKVWGTDGLYVADASVFP
SASGVNPMVTNLAISDWTSQNISKVLNSEKVHGGPRL

Enzyme Prediction     

No EC number prediction in OJD11602.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	218	743	3.5e-59	0.9744525547445255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	7.84e-50	274	499	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	2.66e-36	225	735	9	526	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.35e-30	582	734	5	139	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	4.01e-10	418	721	223	510	choline dehydrogenase; Validated
274143	pyranose_ox	6.34e-07	683	733	483	533	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	2.91e-199	31	750	29	738
UJO19303.1|AA3_1|AA8|CBM1	3.61e-12	217	752	264	815
BAE61169.1|AA3_1|AA8	1.01e-11	225	742	255	786
QMW43910.1|AA3_1|AA8	1.38e-11	225	742	309	840
QMW31885.1|AA3_1|AA8	1.38e-11	225	742	309	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	1.18e-08	222	727	228	748	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
3LJP_A	1.14e-07	466	736	264	520	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	1.98e-07	466	736	264	520	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.98e-07	466	736	264	520	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
7DVE_A	3.07e-06	680	749	441	511	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	1.22e-88	218	749	233	749	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q94BP3|FAO4B_ARATH	2.35e-85	216	730	230	726	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|B5WWZ8|FAO1_LOTJA	8.96e-85	217	751	230	749	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|O65709|FAO4A_ARATH	7.79e-83	217	750	217	726	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q9LW56|FAO3_ARATH	1.17e-81	222	752	231	746	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000005

TMHMM  Annotations     

There is no transmembrane helices in OJD11602.1.