CAZyme Information: OJD10696.1

Basic Information

• Species: Emergomyces pasteurianus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces pasteurianus
• CAZyme ID: OJD10696.1
• CAZy Family: AA2
• CAZyme Description: Alpha,alpha-trehalase [Source:UniProtKB/TrEMBL;Acc:A0A1J9P2U2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1101		119300.20	4.6575

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EpasteurianusEp9510	9078	1447872	128	8950

• Gene Location: location=LGRN01000714:5454-8983(+)

Full Sequence      

MRCTPWPWSFVLLLHSSATLALPFTERIANVVAKNHMLSDSVAKRDDLNCHGFLYPTKFP
GVTWDNDNWRLATTTLDQGHYQSRGSIANGYIGINVAAAGPFFELDIPVDGDVINGWPLY
SRRQTFATISGFYDLQPATNGSNFPWMNQYGGESVISGVPHWSGLVLDLGDNKYLDASVE
AAEISNFTSTLDMKGGLLNWAYTWSPDGREESFDISYQLFAHKLNVNQAVVQLAITPSLD
VDVKVVNVIDGYSAVRTEFVGSGEDGHAIYSSVSPVGVPNVTAHIYATVTGSEEVDLGSL
KLVPNPPYVHMNHSSISQAVDVKLRAGQKSIVTKFVGIASSDGFENPRQVAKDASATAAN
AGYDALLKGHIGEWAKVFPEDSVDDFTVPETGCLPQDVHIVESAITSVTNPFYLLQTTVS
ENAIQTANNAPIHQGSIAVGGLTSDSYGGLIFWDADIWMQPGLVTAFPQAAQTFTNYRLA
KYGQAIENVHTAFTSSKNQTQFSEGAAIYPWTSGRFGNCTGTGPCFDYQYHLNGDIGLQM
INNWVATGDTEHFKEKLFPVYNSVAILFADLLERNGTKWTLNNMTDPDEYANHVDGGGFT
LPMMATTLLYANSFRQMFGLEQNQTWNEMAENMLVLRDPVADVTLEYTTMNGSTLVKQAD
IVLNTFPLRYTDEYSPKNALSDLDYYAAKQSPDGPGMTYAIFSIVANEISPSGCSAYTYA
QYSYSPYIRAPFFQFSEQLIDNWSENGGTHPAYPFLTGNGGANQVALFGYLGLRLLPDFV
LHLDPNLPPQIPHLSYRTFYWRGWPLKAASNYTHTTIQHAQDRQPLPTADQKFNGVPIPV
HVGPESNVTVYSLPSSGLLTIPNRQIGSRVTFPGNMVQCQAVSSPDGYEPGQFPIAAVDG
AASTKWQPKSANATSSLTVSFPDNEISRLIAGFSFDWAQAPPESVAIALHNSPLSLPVGP
DAKSTPSATLSVPSIPGAITVMTLPSITLSNPYDPATTDLNIISRYTGNTTNVTLARAVP
ATRFATLFIWGNQALDDADRRAGNGTGASVAEWSILRAAEGKAAGQFGDGSYDAGAGRGE
AEGGEGKFSIRGVGWLGPYEG

Enzyme Prediction     

EC	3.2.1.28:5	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	411	775	1.7e-78	0.9811827956989247

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224471	ATH1	3.60e-72	67	803	9	726	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
397616	Glyco_hydro_65N	4.22e-45	77	341	9	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
281612	Glyco_hydro_65m	8.39e-24	410	775	3	382	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
237517	PRK13807	1.64e-15	67	633	8	539	maltose phosphorylase; Provisional
397613	Glyco_hydro_65C	0.008	785	819	1	34	Glycosyl hydrolase family 65, C-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS73854.1|CBM32|GH65	0.0	1	1097	1	1093
QSS66944.1|GH65	0.0	1	1092	1	1088
UKZ51236.1|GH65	0.0	54	1056	50	1041
UKZ77068.1|GH65	0.0	54	1056	50	1041
QYS98630.1|CBM32|GH65	0.0	17	1056	7	1042

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	8.74e-41	67	775	22	642	Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	1.23e-16	316	803	226	722	Crystal structure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	2.45e-10	116	826	13	741	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	4.23e-10	116	826	13	741	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78617|TREA_EMENI	0.0	55	1056	50	1037	Acid trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treA PE=3 SV=1
sp|D4B5H9|ATC1_ARTBC	0.0	55	1057	53	1052	Cell wall acid trehalase ARB_03719 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03719 PE=1 SV=1
sp|M1RNJ8|ATH1_CANGB	6.02e-126	59	949	157	1057	Periplasmic/secreted acid trehalase ATH1 OS=Candida glabrata OX=5478 GN=ATH1 PE=1 SV=1
sp|Q5AAU5|ATC1_CANAL	6.02e-123	81	951	121	968	Cell wall acid trehalase ATC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATC1 PE=1 SV=2
sp|P48016|ATH1_YEAST	4.20e-115	35	949	98	1036	Periplasmic acid trehalase ATH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000327	0.999638	CS pos: 21-22. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in OJD10696.1.