CAZyme Information: OEJ92744.1

Basic Information

• Species: Hanseniaspora uvarum
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora uvarum
• CAZyme ID: OEJ92744.1
• CAZy Family: GT62
• CAZyme Description: Dolichyl-phosphate-mannose--protein mannosyltransferase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763	LPNN01000001|CGC1	89272.02	7.2392

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HuvarumAWRI3580	4061	N/A	0	4061

• Gene Location: location=LPNN01000001:481226-483517(+)

Full Sequence      

MAVAKKNDISVSLDKKDKEYNSLYNYLGTKSILFTSSKHDNYLYTLFHYIVIILATLTRA
LYIHKPSEVIFDEVHFGKFASHYLESEYYFDLHPPMGKICTALIGYMVGYKGGFKFDDIG
LEYPSGVPFLLYRLFNCLLGIGICSIIFKILKQLNMKPITCLLGALLVVFDNSHVIESRL
ILLDAQINFWIVVSIYAFIRFYKIQLDVKKHFSWSWYLWLNLTGVFLSFVISIKYVGVFT
FAMVGIAVAFNLWQLLDKDAGVSDKDLLKHLLVRIQALIVCPFLYYLFWFWLHFQILYKS
GPGDEFMSPEFQRTLEESSVVKESRDINYFDIVNLKVSDLDCFMYSNSDFRYPLQYEDGR
VSSQGQQVSCTTNQYNDDNYWFQIIPIDTGINNNHGVGIGATVKLLHVKTNSFLRSHDVA
SSLTATNEEVTTLPIDELNDQNIEYTFFRLDFVSGKPIDPNHPQMKTKYNKFKLIHQKTN
VALKAHIEPTLPDWGLNHYEINGNKKIEEKMYQVWTFDXIHNLPAYRDFSSALKHEKPKL
SFWTKYIELQKKMFASNNALSSEHPFASEPQDWPLTLSGVSYWNKDSERKQIYFIGNIVG
WWIQMAFVFVYIALVVIDLIVVRRGYTFVQAKIRDYLYGSLMWLFLGWLCHYLPFFLMNR
QRFLHHYLPAHLILCVFTAQFLEVGIMIKFIPSEEDEEEEKIDEYKAKKANLKLHLLSIX
IIVAVVWFFYYWKALTYGLETLSVADTKAREWFDIKLQYTKET

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	51	294	7.3e-60	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	8.95e-162	50	754	29	691	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	5.16e-65	50	298	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	4.44e-62	544	754	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCF58596.1|GT39	2.31e-212	50	762	56	759
AJR58664.1|GT39	3.60e-212	50	761	58	762
AJR73892.1|GT39	1.02e-211	50	761	58	762
AJR67078.1|GT39	1.02e-211	50	761	58	762
AJV43443.1|GT39	1.02e-211	50	761	58	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.02e-73	54	671	56	660	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	1.16e-69	54	753	74	748	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46971|PMT4_YEAST	1.03e-211	50	761	58	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	5.91e-192	38	761	41	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	7.71e-162	50	762	64	777	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|O74189|PMT1_CANAL	2.25e-85	52	684	73	688	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT1 PE=2 SV=1
sp|F1QF89|POMT1_DANRE	1.09e-81	54	758	24	718	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000018

TMHMM  Annotations     

Start	End
41	63
129	151
180	202
212	231
236	255
270	292
599	621
636	658
714	731