CAZyme Information: OEJ90326.1

Basic Information

• Species: Hanseniaspora uvarum
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora uvarum
• CAZyme ID: OEJ90326.1
• CAZy Family: GT39
• CAZyme Description: Endo-1,3(4)-beta-glucanase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712	LPNN01000003|CGC5	81982.04	5.8204

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HuvarumAWRI3580	4061	N/A	0	4061

• Gene Location: location=LPNN01000003:58724-60862(-)

Full Sequence      

MSYSRAPMPLPNLTNELNIFGGAKITTNLEIPQNFVSNKETPTPNPVNHSNKFPLPTNDH
ITSLLVPSENDVPSYVQPFIYTLLQDPSLGKKTSLALSSSHQDQKVIGDHYAYNPVAIYE
LILKKLGICEVIEDSIVFGKGKVHLVQGQGMVTVEVANXPDIISVDSQVGIRSVYDIKGG
EGRCYGLQLNNNKKWIVYQEGLSIKVERNEQTGMYQLNIMGNSGIIQLYPDTQDSNSLLS
MDFSNLYNLLKLGNYAQKLTISTSSTSKDTLQFNYXMKHTDREGLIFLLPHHHQDLKTDN
VKNSNLKLYSTVYGFMHGYYTTGIVQFDYSSKEDDLSDFDILSESKTSILHQKLNNLLDN
FSLIKEILVNNDVAECLNNLQNESNLDSMYFSGKIFNKYAWLLFISAELFHDTELSDKIF
AKITECLSKFIQNQQILPLLYDQKWGGIISSGDMNQDFGNSMYNDHHFHYGYFVLTFAIL
GWYNPEWFENNKFYSDLLLRDYCNIDDNDNKFVKFRNFNWYEGHSWANGVWPSLDGRDQE
SSSEDYNSVYAMFLYGSVTKNIKMQQIAKLQLNVMKRSNNKYFLYKDKDFNNEVSINEMK
KNKVCGIFFQNKIDYATYFGLNAEYIHMIHFIPGTFITRYIRDNEFVTEEWNQKLQNINI
DNNGWNGLLKLNKALISSDTIDFFKNKQFNKNNLDNGQSQTLSLILALLWNN

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	42	705	4.1e-145	0.9871382636655949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.37e-146	362	704	8	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	2.45e-137	32	712	67	758	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.32e-19	43	319	4	298	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJV81022.1|GH81	1.21e-121	15	704	71	772
AJV81476.1|GH81	1.21e-121	15	704	71	772
AJV65914.1|GH81	1.21e-121	15	704	71	772
AJV78792.1|GH81	1.21e-121	15	704	71	772
AJV79241.1|GH81	1.21e-121	15	704	71	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.40e-59	261	707	272	715	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	4.60e-59	261	707	297	740	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.00e-57	261	707	272	715	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.33e-20	375	656	318	604	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	7.00e-16	390	679	361	652	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12168|ENG2_YEAST	1.64e-121	15	704	71	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	2.77e-79	50	707	30	699	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.28e-78	34	707	404	1109	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	2.38e-76	54	707	225	899	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	6.48e-76	54	712	81	740	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OEJ90326.1.