CAZyme Information: OEJ89109.1

Basic Information

• Species: Hanseniaspora uvarum
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora uvarum
• CAZyme ID: OEJ89109.1
• CAZy Family: GT8
• CAZyme Description: GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		71979.70	8.9192

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HuvarumAWRI3580	4061	N/A	0	4061

• Gene Location: location=LPNN01000004:534893-536755(-)

Full Sequence      

MGLDIPSVFTKENAFSLTKSLKYRATHTKSFYAFMVVVVLTTFLLRKSXILPRFMLKPPK
NWLQRYKDNLKKIIEDEEVSSPLARERLTKKTVRINFGGKNGCIRRWLLLNSNDEYATLA
YSNYRNIAPIKAKNDGLTLSLKDRLNFDDLCENVSNQNSGDKFIIGIFHPFCNSGGGGER
VLWELCKTILDKYENNKNFKIAIYTGDVDIKPEDIIEKVKFKFGINLNIKKICFIYLEGR
SKVEGKSWPVFTLLLQAISSIFLLKNAISKLPPDCFIDTMGYPFVYPVMKFFYDVPIVSY
THYPIIQRDMLSMNNLPMIKRVYWMILYVWYKFCGYSVDYSIVNSTWTKNHMDSIWKMID
NNIVYPPCLKAEDTKPLSNDHKKKWQCVLVAQYRPEKRHELAIDQYKKYLDTFEGSDINK
SLNLIFVGSIRSVEDKVFLRQLKYRAHKTLKIPEDKLIFKTNLSYADLLAEIKDSQFGLN
TMWNEHFGISVVEYFANNTIPLAHASAGPLLDILGPVLKNNSQFEEFSKKLFFIDASDPD
YXEETAGKYSELYEVFKAVDSIGSSSNIWKELGNKGYDYVLEKFSNEKFDEDFNEKVLNY
LVNDILKSKTKRAEADVECQ

Enzyme Prediction     

EC	2.4.1.131:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340835	GT4_ALG11-like	1.34e-150	164	592	2	419	alpha-1,2-mannosyltransferase ALG11 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.
406369	ALG11_N	9.08e-93	164	356	2	208	ALG11 mannosyltransferase N-terminus.
215511	PLN02949	2.30e-85	165	513	36	393	transferase, transferring glycosyl groups
340834	GT4_ALG2-like	1.92e-12	245	510	69	335	alpha-1,3/1,6-mannosyltransferase ALG2 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans.
340831	GT4_PimA-like	8.20e-10	165	599	2	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLG72516.1|GT4	2.59e-122	56	598	31	559
QLQ78976.1|GT4	1.24e-121	38	606	30	585
QEU58959.1|GT4	5.46e-120	95	595	60	556
QLL31462.1|GT4	1.03e-119	52	612	33	578
AMD21076.1|GT4	1.75e-118	53	593	31	553

PDB Hits     

OEJ89109.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6CLD6|ALG11_KLULA	1.19e-118	95	595	60	556	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG11 PE=3 SV=1
sp|Q75B12|ALG11_ASHGO	7.24e-110	54	593	40	562	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ALG11 PE=3 SV=1
sp|Q6FWD1|ALG11_CANGA	2.04e-107	166	612	49	501	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALG11 PE=3 SV=1
sp|P53954|ALG11_YEAST	2.58e-95	164	599	73	536	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG11 PE=1 SV=1
sp|Q6BVB2|ALG11_DEBHA	8.52e-82	48	589	22	586	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALG11 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000004

TMHMM  Annotations     

Start	End
28	45