CAZyme Information: OEJ88942.1

Basic Information

• Species: Hanseniaspora uvarum
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora uvarum
• CAZyme ID: OEJ88942.1
• CAZy Family: GT2
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846		93145.48	4.8571

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HuvarumAWRI3580	4061	N/A	0	4061

• Gene Location: location=LPNN01000004:1268223-1270763(-)

Full Sequence      

MNEFDVKKLLAELTVBEKISLLAAVDFWHTTPIERLDIPSIRVSDGPNGIRGTRFTPWEA
CKSACFPNGTALASTFDAELLEQAGALMAKEAKHKSAQIILGPTANIQRSPLGGRGFESY
SEDPYLSGVASASIVKGIQDNGVGATMKHYACNDMDHERFAYDVKVSQRALREIYLEPFR
LAVKYADPLLFMTSYNKVNGYHCSASKQLLDEILLTEWKSXAVVISDWYGTSHIVEGIKN
GEDIEFPGPARFRTXELVKQLLFCKAEAADGTIFTEHDIDVRVEKILNLVKYFVDINGST
KFETFENDKNDTPETSALLRKIAAESIVLFKNENKLLPLKPEDDIIVLGPNAKAKNASGG
GSASMKSYYTVSPYEGICNAVGKELPYAKGCDNHKSLGNLFEQCVPKGSSGNGVILKTYL
NXALGADGEEPFVTELVESSFVPMFDFDHEKLDKDKAFYATFEGTFTPEESGEYEFGCQV
LGTALLYLDGKLLINQKDNQXKGVSFFSSGTVEKTGVVTLEKGKXYDVKIEYESAYFSSI
SDSIGGGGLQVGVNKVIDVAEEIAKTAALAAKHDKVVLVIGLNGEIESEGYDRDDMALPR
ATNELVVAVLKANPNTVIVNQSGCPVEMHWIKEAPAVLQAFYGGNELGNAIADVVFGKTN
PSGKISITWPKRNEDNPAFLNFESHMGRVVYGEDIYVGYKYYEKKQMQVLIPFGYGLSYT
TFEQSNLKVSVDEAKDSLIVSADIKNTGDVFGKEVLQVYIGRRSKSVVPRAVKELKGFKK
IGLDPGETKTVTVELSLKDSASYFNEYRDSWHLEAGXFYVAAGSSSDEANLLQDFTVKEE
KFWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	7.7e-56	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.86e-65	66	842	120	762	beta-glucosidase BglX.
224389	BglX	7.97e-58	35	392	57	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.61e-51	507	699	35	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.29e-29	9	793	56	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.26e-28	35	289	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGN15027.1|GH3	0.0	1	846	1	845
BAO39306.1|GH3	0.0	1	846	1	845
ACY95404.1|GH3|3.2.1.21	0.0	1	846	1	845
BAP70809.1|GH3	0.0	1	846	1	845
CAG99696.1|GH3	0.0	1	846	1	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ABZ_A	0.0	2	846	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
3AC0_A	0.0	1	846	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	3.73e-138	5	837	4	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.24e-100	12	826	11	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.40e-97	6	841	4	717	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	0.0	1	846	1	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|Q9P6J6|BGLS_SCHPO	9.69e-242	1	846	1	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	6.09e-239	1	846	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	2.08e-234	1	846	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	5.70e-234	1	846	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OEJ88942.1.