CAZyme Information: OEJ88931.1

Basic Information

• Species: Hanseniaspora uvarum
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora uvarum
• CAZyme ID: OEJ88931.1
• CAZy Family: GT2
• CAZyme Description: putative mannosyltransferase YUR1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		56401.02	4.9890

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HuvarumAWRI3580	4061	N/A	0	4061

• Gene Location: location=LPNN01000004:781795-783207(+)

Full Sequence      

MIIYSVLVLFISVFVNAXNLTPFDLDKDLNTFXNLNTNYEQTLYKLWEAHSEYIHHPLTL
ELQKLDKFYQFNYVDKLNLLNTYNNSFDNVPSAILDDIYXELPFLNHSIDNLKKYKQNTV
YILIRNFELDDICKTILNYVNRVKYPFYDFVFLNDKAFDPYFIEKTSHYILSRINTKSDT
LSKQLITINYGLINNDVWDPLNKIEEYNPSLNITELEEKWKTQELENVLYGGSRSYRNMC
RFQSMNFYKHPIFKKYKYTMRMEPGVQYSCDFDPFLELNEKTKYAFSIALLEYENTIPTL
FDTYKKYPTLKYKQAELFKFIEGVDDGYNRCHFWTNFEIISLDWIQSYEYNSFMEYIDKT
AGFYLERWGDAPLRTLAVVETLSIDEVQWFDIGYYHNPFSSCPGSLHARKLRKCTCDLFD
HDKSYKPKDDEDSHEYRVEVGLQDFSCLNEWWRYGSGKEFSFKDNNNLFI

Enzyme Prediction     

EC	2.4.1.131:20	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	118	397	3.8e-68	0.9816849816849816

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	2.03e-78	110	460	74	395	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	1.10e-60	109	398	36	313	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCF58793.1|GT15	1.24e-68	61	460	30	412
AET39965.1|GT15	2.80e-68	119	460	93	419
CDR44157.1|GT15	4.34e-66	38	468	33	419
CAR24010.1|GT15	4.82e-66	113	460	87	419
CCK69373.1|GT15	5.07e-66	88	465	50	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A07_A	1.00e-46	105	403	92	388	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]
1S4N_A	1.07e-46	97	417	8	315	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
7BOO_A	7.12e-42	123	430	74	374	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33550|KTR2_YEAST	2.04e-64	112	460	86	420	Probable mannosyltransferase KTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR2 PE=3 SV=1
sp|P26725|YUR1_YEAST	3.09e-64	110	468	85	428	Probable mannosyltransferase YUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YUR1 PE=1 SV=1
sp|P87207|MNT3_CANAL	3.45e-58	118	416	74	355	Probable mannosyltransferase MNT3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT3 PE=3 SV=2
sp|P27810|KTR1_YEAST	8.34e-55	119	417	74	360	Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR1 PE=1 SV=1
sp|P46592|MNT2_CANAL	8.13e-53	108	454	131	460	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999771	CS pos: 17-18. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in OEJ88931.1.