CAZyme Information: OEJ86945.1

Basic Information

• Species: Hanseniaspora uvarum
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora uvarum
• CAZyme ID: OEJ86945.1
• CAZy Family: GH81
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850	LPNN01000005|CGC7	95222.82	5.3585

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HuvarumAWRI3580	4061	N/A	0	4061

• Gene Location: location=LPNN01000005:797013-799565(+)

Full Sequence      

MTVSFDPDTLLKKLTLDEKIQLLTAKDYWHTVPIPRLNIPSIKVTDGPCGSRGSKSFNST
KTAAFPCGTALGSLFDKKRLFEIGQVMATEAEHKSAKVILGPTTNIQRGPLGGRGFESIS
EDPLLSGLSAAEIVKGIQDSGRVMATMKHYVCNDMEIDRFGYDVLVTERALREIYLEPFR
LAVKHADPMFFMTGYNKVQGVHCSTSXKNIKQILHGEWESRALVMSDWYGSSHPMESIKA
GLDFDFPGPEKFRSVQTIKHLLFSKAETRDGTIFNENDIDVRVLKILNMIKYFVDXYGTT
DFTFDEDTKNNTKETSQFLRQIAAEAIVLLKNEDSILPLKKSDAEDLCIIGPNAKAKXHT
GGGSASLNAYYIVSPYEGILNVTEKESLPYSKGCDAHKTLSNFIENCXTEDGEKGLSVKF
YQKENHRETGEKPFKVEVVDRSFNKMSDMRDPHIDLEKKLFYCDWEGLYTCQDGDGIYEF
GCQVAGTALFYLDDKLIIDNKHDQEGGDFAYKSGTIEKKACXZLKHGQTYKVRIEFGSIS
TSKLNVVSEITFGALQVGINKVIDSKLEIEYAVSLAKKHKNCIVVIGLNGEYETEGDDRP
HMDLPGLTDTLVTEILKANPNAIVVNQSGTPVTVPWIDQCKVFLQSYYGGNELGNAIADV
IFGNVNPGAKLSLSWPKKNEDNPAFLNFTSHMGRVLYGEDIYVGYKFYEHMKREVEFPFG
YGLSYTDFEISDLKTSLKDNDLXVEVTVKNTGKXEGSEVVQVYTSRVSESQAPRVPKELK
EFEKVTLAPGKQTVVKLNLSVKDSFSYFNEIRDKWHLEAGKYQILVGNSSVNLPLSNELE
IEDDLYWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	245	1.1e-50	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.62e-52	8	831	39	755	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.23e-48	327	705	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	2.06e-46	11	395	35	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.66e-38	9	842	55	778	Probable beta-xylosidase; Provisional
405066	Fn3-like	1.89e-22	758	830	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYD37768.1|GH3	0.0	1	850	1	850
QPG75292.1|GH3	1.88e-307	3	850	1	840
QPG75036.1|GH3	2.00e-304	3	850	1	840
QPG74622.1|GH3	2.64e-302	3	850	1	840
AKS48904.1|GH3	1.26e-300	3	847	1	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.96e-291	5	850	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.25e-285	5	850	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.28e-118	3	841	1	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.90e-88	14	844	12	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.64e-87	10	844	7	716	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	4.93e-286	5	850	4	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|Q9P6J6|BGLS_SCHPO	2.29e-238	6	850	5	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	5.22e-233	3	850	2	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.37e-227	3	850	2	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.37e-227	3	850	2	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000003

TMHMM  Annotations     

There is no transmembrane helices in OEJ86945.1.