CAZyme Information: OEJ84925.1

Basic Information

• Species: Hanseniaspora uvarum
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora uvarum
• CAZyme ID: OEJ84925.1
• CAZy Family: GH38
• CAZyme Description: Killer toxin-resistance protein 5

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1350		157588.05	4.5536

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HuvarumAWRI3580	4061	N/A	0	4061

• Gene Location: location=LPNN01000007:280918-284970(-)

Full Sequence      

MLLKSFVYYIAFLISIFSSSFSLDVSEEAASLKVWNSFLKMYPLLSVINSDESFLQRQDI
VNSIIEELMLQEVEQDSSIHSNVYKYLYNXSPMLANVYKSYYDLNMPLILNKSPYQKPQF
ILNGESFDLDEIYYLKSDKLVPNAEHYNVENSKQPIIGSVENLIKNLGEKEDEVNERLYQ
AKYINNDKPLLELHCSLNEEFFELFVMEATEGKFNLVWYDTSNITFFDPKENFMNDLYEL
KYDNVEGLSLNGTDIVSDTQFKDKQRSNQKGFLSNLDIILTLKAIEQHVSDPWETLDVLF
NNSNDLPFSDYQQQLSRDFNLNKEDVLAKKDSIIQRDLNTLKHNGISYDNIGLYVNGINI
LNNHASRMGVLDAIIYEFEMMNGLKNSILKVFPQLSSRITLESVKKLLLEYEVMYSKLSM
FNQPRKFDLQKTEKDTDIVLFVNDLENDFQYKDLKFDIREFLSSSHEKEFPGIKENWNDI
VFLLDMNNPSMVRDFIRVITVISDGFPQRIGFIPLTDDLKLLNKILQVYKSPIKLANLLK
DPSVRTAKSKYETKAEELQANIAKLLENMNFTENEALIVNGEIFPYRENTWNYYITSVMN
KDIQFIKTFLQNMEYRGESIDDDNLKLRDVLFSESFSFVERDLTLTPDYFGDAMVTRTNY
DYILELRDLGHVFEITKDTEYEIIHTITLVADFSNVNEWKNIYTLLQNNLFGVKIRLVTL
TDPTNKQWLNLQEXIYKAPDVFLSYIQKHESSKKNSFKPLLQTVDLNNWLLDLSYKQLQS
QRFVVLNGRFVDLTSYNVTKSISTQSWFNFIKFESFKTLQCVTALNIAFNFDENSIIPMQ
TVEDIVSHLIFFSHRELSQGKENFQQGVHYTAETVQTRHPLNQVLLHIEADENLDIFLNS
KNFVKDSMSKPIDLVLVIDPIEERSNKFIDIVRNLRALKKYLNLQILLMPTTELTLFPRQ
TIFGKKHNLQDLITDNSNQFEINKVPVYKKLENHQLENISDTVILADLYVQKPIKSIKGC
TRTTVETNLSNVCMSIVVDDEGAEEICRVSTMSTFGYAQIRIPASERRRLKVVSCDPQYD
VLEMTLDMNADFTAWENFQTRDLLTRSVLVHVEKNNEEGEINTFDQLSVLSVVQNKQDLS
KLSDILINKNNKYFIWNTESSGLSKNNILEALPAEYDVTVINFNWADWIRPTNLISQQMK
FAKFMLVDVNLPLEVNELLFLDLEKQIDEKWIEILKAGALDRLISTDDILGFEEYSDSDL
VDKYWKTEEYWTKYLESNDLDXFYKTDNYVXKLNDFRKNNYGDVLRVHYQRLTTDINSLN
RFDESLMNNAQVLVSMSSISFSQDLELDEL

Enzyme Prediction     

No EC number prediction in OEJ84925.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1149	1339	1.4e-26	0.7419354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408201	Thioredoxin_14	7.77e-15	427	625	1	230	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
133054	GT8_HUGT1_C_like	1.67e-10	1167	1339	46	213	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCH58251.1|GT24	9.98e-108	94	1339	90	1280
AJT75647.1|GT24	5.96e-101	60	1348	54	1318
AJT79574.1|GT24	2.02e-100	60	1348	54	1318
AJU08408.1|GT24	2.02e-100	60	1348	54	1318
AJT89877.1|GT24	3.72e-100	60	1348	54	1318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	2.37e-12	353	1339	333	1392	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	5.32e-12	353	1339	333	1392	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	8.96e-12	353	1334	326	1380	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	1.20e-11	353	1339	333	1392	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	4.27e-07	423	958	387	931	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P22023|KRE5_YEAST	2.55e-99	60	1334	54	1304	Killer toxin-resistance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE5 PE=1 SV=2
sp|Q09140|UGGG_SCHPO	5.32e-10	967	1339	1017	1369	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU1|UGGG2_HUMAN	2.33e-06	1180	1339	1291	1443	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
sp|Q0WL80|UGGG_ARATH	4.05e-06	1176	1339	1357	1513	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999769	CS pos: 22-23. Pr: 0.9775

TMHMM  Annotations     

There is no transmembrane helices in OEJ84925.1.