CAZyme Information: ODM23919.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM23919.1
• CAZy Family: PL4
• CAZyme Description: Apple domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1E3BSI6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	JXNT01000001|CGC29	52242.22	6.0290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000001:4089520-4090937(-)

Full Sequence      

MRRHLRKLRSTPAVVLLFLILLFLLPYDNSFSPRAAIVSAVPALFEKRWWLINKPGAYPV
DFSQDVAVLVKSGIGTKERIPSWLQAHEHMELSDLLLIGDFATLPGQEYQYRDQRLPVHD
VLAWMIGRGYMAEDLDHPRLQKYYNLTRAIDREDVGAAQEMSGSFGWELDAMKFLSGMEL
LYSRFPDKKWYIMADDDTYLIQPSFKRLIEHFNPNREQYLGNPVGGEDCRFGHGGSSIIL
SHRAVSHLTSDREYLATAYRESLDETWGDKRLAVALNRLEIYIYEEYAAFFNGERPRTSK
ITKERLCTPVLSFHGLSSSSDMLSVSRTFEHATEQVLWIDLWNIPTSDKSDNAHLPKAST
SLFDDPIYDTGHANWDYVGRPDEWTQSVEDVSSVETCKQICREERPDFCLAWTWDSNEKK
CHMSWWIIKGDQAEGRTSGLNVPVVKGLVRSCRP

Enzyme Prediction     

No EC number prediction in ODM23919.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
394981	PAN_1	4.32e-05	387	426	18	55	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.
214680	PAN_AP	5.41e-05	383	425	16	57	divergent subfamily of APPLE domains. Apple-like domains present in Plasminogen, C. elegans hypothetical ORFs and the extracellular portion of plant receptor-like protein kinases. Predicted to possess protein- and/or carbohydrate-binding functions.
367085	Fringe	1.80e-04	178	225	73	122	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
238533	APPLE_Factor_XI_like	4.50e-04	372	423	9	54	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR84170.1|GT31	0.0	1	454	1	454
QMW46572.1|GT31	2.08e-155	6	453	5	446
UDD63456.1|GT31	2.08e-155	6	453	5	446
BAE56843.1|GT31	4.17e-155	6	453	5	446
QRD93690.1|GT31	8.38e-155	6	453	5	446

PDB Hits     

ODM23919.1 has no PDB hit.

Swiss-Prot Hits     

ODM23919.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.983844	0.016190

TMHMM  Annotations     

Start	End
13	27