CAZyme Information: ODM23373.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM23373.1
• CAZy Family: GT4
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1E3BQW3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600	JXNT01000001|CGC22	69469.11	7.3423

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000001:2628293-2630150(+)

Full Sequence      

MRLQRVAILLGVFIVACFSLNLLRERKPKTPPVPSRPQATPPTPLKPIEYYHQAAQQSSY
PPEKTHPVTRLIQNADQQFDQTRSRQSQTLQDAVREYQRRYNMHPPPHFDKWFEFAQAKG
VKMIDEYDTIYHSLLPFWGLGPRTIRARAREALGFDNQMLGILIRGGKVTMADGGGDGYK
WQREATIGMMKGFIQYLPDMDLVFNLHDEPRVVLPSDDLQRLVNSAKDHAIPESFGNRSP
VNSWSPRPTDVNKGDRIDEVRTTRFNRFAHQPTWTHSRISCPANSPARSLEENPVDNTTA
YAYGELGFIYNTTAASDICNTPSLRYTYGFFDRPNAFDIVHDLFPVFSQSKISSFQDIVY
PSPWYWADKVPYEGRKDYEWDSKLDKLYWRGSTTGGFSRAGGWRRQHRQLFVSNANALDT
TKALSRDENGAWVSKEVSRRDYRDLFDVKFTFIGQCDPEDCAAQGEYFDVAKHAGQQDAW
GYKYLVDIDGNAFSGRYYAFLQSNSLVAKIAIFREWHDEWLKPWVHYVPLGLRGDDYVET
MRFFTAEEEGRSMAPRIAQQGQQWAKEVLRNEDFEVWLFRLLLEYGRLIDDNRDKLGFVL

Enzyme Prediction     

No EC number prediction in ODM23373.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	321	589	4.1e-83	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	5.50e-21	341	588	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.52e-10	345	588	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83603.1|GT90	0.0	1	600	1	600
QQK41201.1|GT90	0.0	1	600	1	591
CAP94438.1|GT90	0.0	1	600	1	592
UCK57446.1|GT90	2.49e-316	1	600	11	619
BAE54850.1|GT90	1.41e-315	1	600	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	7.04e-11	345	589	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	5.55e-10	322	592	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.40e-58	61	595	147	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	3.64e-10	345	595	164	397	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	3.76e-10	345	589	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.91e-09	322	592	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.36e-09	322	592	123	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.375826	0.624180	CS pos: 16-17. Pr: 0.4155

TMHMM  Annotations     

Start	End
7	24