CAZyme Information: ODM23239.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM23239.1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	JXNT01000001|CGC34	36023.12	7.4153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000001:2262845-2263939(-)

Full Sequence      

MQFALPPRGGALPLHTSSGRSRLSYQRRRQLKVAAILGFAVISLFFLFSYLHSSSIISTI
PAGTSGIVIVTVLDRAALSEKYIHRIKKNREDYAKRHGYTNFFADVSDYESTLDNAPRSW
AMVPALRHAMTLHPHSAYFYHLGPHALIMDPSKSLESHLLGKNRLESLMLKNVPVVPPNS
VVKTLPHLTSKDIELVFTVDDADLSTGSFVIRQGEFADFFLDVWSDPLYRNYNFVKAETH
ALDHIVQWHPTILARLALVPQRIINAYSKDSPDVTADGIYRDGDFVIRFHACESDPSRSC
DKEMELYYDLWEKKVDGD

Enzyme Prediction     

No EC number prediction in ODM23239.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	66	296	7.4e-71	0.967479674796748

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	8.09e-61	63	300	1	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83407.1|GT34	1.19e-229	1	318	1	318
AAY62606.1|GT34	1.20e-153	1	315	1	315
CAK38855.1|GT34	2.39e-146	1	315	1	315
BCS01218.1|GT34	9.70e-146	1	315	1	315
BCS12963.1|GT34	9.70e-146	1	315	1	315

PDB Hits     

ODM23239.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	4.25e-37	75	308	81	307	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	8.46e-34	82	292	123	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q10359|GMH3_SCHPO	7.69e-27	88	292	113	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.49e-26	82	318	123	357	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|P50108|MNN10_YEAST	3.39e-25	88	313	151	381	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000042

TMHMM  Annotations     

Start	End
33	52
56	78