CAZyme Information: ODM22603.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM22603.1
• CAZy Family: GT31
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		51456.21	8.5856

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000001:510251-511747(-)

Full Sequence      

MSSVKQVDRPSLLNPLRPLWSLTVAFVLWKSLLFLVVTACPGPGYDTSTSLLPYLNRSPT
RPAADVGVGSTLPLKFVRWDPIYFVHIVQHGYVYEQEWAFGYGFTSIWRFVASFLNPSEE
VGNVAQVAWTGVGLSHLAHYLSVLALYKLSANVFGRETSTQRLICFLSAALHIIAPAGAF
LSAPYPEPIFSFLNIFGLYLYSSSFLDDGAGRKLPRDAKLLGAAVSFAVATTVRSNGILS
GFLFAYDAIWQLRMVLLHGLSWDVVVRLGVIVLGGCVVALGMVLPQWVAYTTYCTTDSRP
WCQWTLPSIYGWVQEQYWNVGFLRYWTVSNTPLFLLAAPMLVLLCCASLWALKMPWATVK
ERPTTVIDRTMSPEDTDSLLIRLAVPQGLLAVMAFTSYHVQIINRISSGYPLWYWYLVCL
VVDRVGESPSAAKSNRLFAIVLQAMVVYGLIQAVLYGSFLPPA

Enzyme Prediction     

No EC number prediction in ODM22603.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	24	463	1.7e-110	0.9926289926289926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	8.56e-42	22	463	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.71e-15	78	463	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR82784.1|GT76	0.0	1	463	3	465
BCS01167.1|GT76	2.04e-190	8	463	11	469
BCS12914.1|GT76	2.04e-190	8	463	11	469
QMW40534.1|GT76	2.26e-190	1	463	1	452
QRD82967.1|GT76	9.14e-190	1	463	1	452

PDB Hits     

ODM22603.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	5.83e-184	1	463	1	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.81e-162	12	463	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	8.36e-91	17	463	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	3.36e-83	17	463	17	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.56e-46	21	463	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997493	0.002540

TMHMM  Annotations     

Start	End
15	37
163	185
223	245
266	288
333	352
438	460