CAZyme Information: ODM21482.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM21482.1
• CAZy Family: GT2
• CAZyme Description: putative beta-glucosidase btgE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651	JXNT01000002|CGC3	67206.57	4.2386

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000002:457804-459806(-)

Full Sequence      

MRATLLAAAAIAGTAVADGVHMHRRGHEAAHQRRALQNPAPSSVASSVAEETCGCTTEVI
TYYGSPTLIPLPETTSTPAPAPVTTSSTVPPADLTTTLESTSYTTVTVVTTTPSASPSPA
PEPETSSVPAETPETPVETPVETPSQAPSEAPSSPAPAPSSSTETPVVESSTWVPQTSSS
VIPSPVAPVTTPSSVAPATTSTAVVELPTPDITSFTSTGVYTIPAKTITVTDSTTVCGAA
STELPSGSHTIGGVTTVVETATTVTCPYATVKPTGSTTTSVIETTTYVCPSAGTYTIAPI
TTYVPTNTAVVYPTPATYTPGTYTKPDRTMTITNTDYTYVCPEESTTSVSTAVSTPAVST
TPAVSTTPAVSTTSAIPSSSTSSSTPIPSAVNGQMGMTYSPYANDGNCQDEATVLKNVGE
IAKKGFSHLRLYATDCNGLEYVGKAAKQHGLKMIIGVYIDDSGISGAQEQVTAITKWAQW
DLVTLIVVGNEAIQDGYVDVGSLAGFITSAKQSFKSAGFTGDVTTSEPINIWQQEGSSLC
SAIDVVGANIHPFFNAQTTAEQAGKFAKSEVKILEGICSGKDVVILETGWPNNGQANGAA
VPGKEQQATAIKSLVQEVGSQSVFFSFSNDLWKDAGEFDVERYWGCIENFN

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	417	647	5.1e-21	0.9035369774919614

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.02e-57	348	650	1	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
223021	PHA03247	1.03e-05	20	210	2661	2842	large tegument protein UL36; Provisional
237864	PRK14950	1.66e-04	60	192	343	446	DNA polymerase III subunits gamma and tau; Provisional
236766	rne	2.03e-04	32	206	817	1012	ribonuclease E; Reviewed
282904	Herpes_BLLF1	2.94e-04	44	363	420	722	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR87253.1|GH17	0.0	1	651	1	651
QMW38366.1|GH17	4.60e-177	3	650	4	601
QMW26283.1|GH17	6.50e-177	3	650	4	601
BAE55626.1|GH17	6.50e-177	3	650	4	601
QRD87628.1|GH17	6.50e-177	3	650	4	601

PDB Hits     

ODM21482.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1C499|BTGE_ASPCL	1.15e-178	1	650	1	564	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	1.16e-177	3	650	4	601	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|Q2US39|BTGE_ASPOR	1.16e-177	3	650	4	601	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|A1DBG6|BTGE_NEOFI	6.30e-167	1	651	1	552	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	1.94e-166	1	651	1	565	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001256	0.998730	CS pos: 17-18. Pr: 0.9611

TMHMM  Annotations     

There is no transmembrane helices in ODM21482.1.