CAZyme Information: ODM20748.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM20748.1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	JXNT01000003|CGC7	41362.99	4.7050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000003:1517140-1518234(-)

Full Sequence      

MLTFRKSLIAAIFLVACILILRSSHSSSSSSLSSSIADIPPITPDENVNEDNLPKKGTVQ
QLPIQPAPTASLRDRLRYHFPYDISNKFPAYIWQTWKYDPSSFWFIDDLRAPEASWTELH
PGFVHQVITDDTQRHLIKYYFASIPEVVEAYEALPLAVLKADFFRYLVLLARGGIYSDID
TTALQPAPEWLPAELDQSTVGLVVGIEADPDRDDWQKWYSRRIQFCQWTIQAKPGHPVLR
DIVAYITEEALRMKKLGVLKTKKMDKTVVEFTGPAAWTDAVFRYLNDPEYFKIDPETSRN
VTYEDFTGQEDRRKVGDVVVLPITSFSPGVGQMGAMDVDDPMAFVQHDFEGNVVPYPAEA
IESY

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	114	193	1.9e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.27e-39	70	345	64	338	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.16e-17	115	194	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89353.1|GT32	1.90e-253	1	351	1	353
CBV36935.1|GT32	2.12e-185	1	358	1	358
QRD84625.1|GT32	4.04e-184	1	352	1	356
QMW33062.1|GT32	4.46e-184	1	351	1	355
BAE62819.1|GT32	4.46e-184	1	351	1	355

PDB Hits     

ODM20748.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	3.96e-87	70	352	81	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.50e-74	73	352	129	392	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	4.69e-73	65	341	107	372	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.93e-65	6	352	15	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.498335	0.501662	CS pos: 22-23. Pr: 0.3509

TMHMM  Annotations     

There is no transmembrane helices in ODM20748.1.