CAZyme Information: ODM19875.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM19875.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
924		100458.80	6.8004

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000004:1310446-1313537(+)

Full Sequence      

MAPNEELLPSGWEDLDRQMGQLFMMGFDGTSVNPQIRSLIENHHLGSVLLSAKNLKSAEE
ATRLVLELQTIARNAGHPVPLLIALDQENGGVNSLYDETYIRQFPSAMGVAATGSQALAH
EVALATAQELRAVGVNWILGPVLDVLTNVKSQPLGVRTTGDDPQEVSQYGAEFVRGFQEA
GLATCGKHFPSYGNLEFLGSQSDVPIITETLDQLSLSALVPFRNAIAHGLDSMMVGGVSM
SSAGVNVMHACLSEQVVDDLLRKDLDFRGVVVSECLEMEALTHNIGVGGGTVMAKNAGCD
IILLCRSFAVQQEAINGLKLGVENGIISRGRIEQSLRRVLQMKARCTSWEQALNPPGLHA
LTQMQPSHTSLAKRAYGGSISVVRDKRNLLPLSSILDPKEELLLLTPLVKPLPASAVSRS
VAAHLGLSLEDPIAWDRTASVLSGESVFKALGRSLSRQRNGRVLHTSYTTNGVRPIHENL
IERASAVIVVTADANRHLYQHGFTKHVSMLCRMSQAGQPREKPLVVVAASSPYDFATDRS
IETYICTYDFTEPALEALVQVLYGELTPTGSLPGSISRSQKLHQARQHWLVESWNEDRDA
HALDALLDIVRADNAQDSELQGVTSSSFLLRRAEVVEAHLVVRNSSTQALYGFCSTYFFR
STGTGVIGSLIVDPSRRRLSIGRSLHHRAIHTLLQCKGIKRFQLGSRLPGIYLGIPATHP
VERKRLRQWFANLGWNTALSRPVCSVVLRNATTWTPPNGLVEALQNHTAVRYDLVYGWDY
AEVVLDHVRTNLRPGLQDLYQVALGGAPDCGIIRALRADDGEMLGSVVIYNARSVLAAHM
AALKNQPVLAGGVSSPVISPLVGEYATLLQGLMFLGIKQSRKQGAKAVVLDCVDGDSNLD
CLSGMGFEMLHQYEEVNCDATCTQ

Enzyme Prediction     

No EC number prediction in ODM19875.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	77	303	2.5e-54	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.60e-71	15	393	3	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.03e-63	15	340	2	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	4.85e-35	19	368	1	336	beta-hexosaminidase; Provisional
178629	PLN03080	2.24e-10	104	573	114	585	Probable beta-xylosidase; Provisional
185053	PRK15098	8.05e-09	15	343	47	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR90827.1|GH3	0.0	1	921	1	921
BCS15461.1|GH3	0.0	1	920	1	922
BAE65506.1|GH3	0.0	1	920	30	952
QMW48185.1|GH3	0.0	1	920	1	923
QMW36125.1|GH3	0.0	1	920	1	923

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.48e-99	13	735	7	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	5.33e-66	15	577	13	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	8.39e-44	15	576	44	617	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.10e-43	15	576	18	591	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.62e-43	15	576	48	621	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	4.32e-43	15	576	44	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	2.91e-38	16	573	29	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	2.86e-31	30	577	49	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|B4SRK3|NAGZ_STRM5	1.39e-30	22	330	1	307	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	2.56e-30	22	330	1	307	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ODM19875.1.